Coding
mRFP1

Part:BBa_E1010

Designed by: Drew Endy   Group: Antiquity   (2004-07-28)
Revision as of 10:37, 27 October 2020 by NJAU-Chappie (Talk | contribs)

**highly** engineered mutant of red fluorescent protein from Discosoma striata (coral)

monomeric RFP: Red Fluorescent Protein. Excitation peak: 584 nm Emission peak: 607 nm


Usage and Biology

Robert E. Campbell started with Discosoma RFP (DsRed) and evolved a faster folding, monomeric variant. See paper listed in source. Codon optimized for expression in bacteria (?? DE)

AmilCP amilGFP RFP.jpg On cultures BYR small.jpg Pellets BYR.jpg

iGEM11_Uppsala-Sweden: Expression of chromoproteins. The images above show E coli No part name specified with partinfo tag. expressing amilCP BBa_K592009 (blue), amilGFP BBa_K592010 (yellow) and RFP BBa_E1010 (red).

Peking iGEM 2016 has fused this part with triple spytag. The fused protein is participate in Peking’s polymer network. By adding this protein, the whole polymer network become visible in most conditions. If you want to learn more about Peking’s polymer network and the role of mRFP in this network, please click here https://parts.igem.org/Part:BBa_K1989004".


Allergen characterization of BBa_E1010: NOT a potential allergen

The Baltimore Biocrew 2017 team discovered that proteins generated through biobrick parts can be evaluated for allergenicity. This information is important to the people using these parts in the lab, as well as when considering using the protein for mass production, or using in the environment. The allergenicity test permits a comparison between the sequences of the biobrick parts and the identified allergen proteins enlisted in a data base.The higher the similarity between the biobricks and the proteins, the more likely the biobrick is allergenic cross-reactive. In the full-length alignments by FASTA, 30% or more amount of similarity signifies that the biobrick has a Precaution Status meaning there is a potential risk with using the part. A 50% or more amount of identity signifies that the biobrick has a Possible Allergen Status. In the sliding window of 80 amino acid segments, greater than 35% signifies similarity to allergens. The percentage of similarity implies the potential of harm biobricks’ potential negative impact to exposed populations. For more information on how to assess your own biobrick part please see the “Allergenicity Testing Protocol” in the following page http://2017.igem.org/Team:Baltimore_Bio-Crew/Experiments


For the biobrick part, BBa_E1010, there was a 27.6% of identity match and 56.9% of similarity match compared to the allergen database. This means that the biobrick part is not of potential allergen status. In the 80 amino acid alignments by FASTA, no matches found that are greater than 35% for this biobrick.


>Internal Priming Screening Characterization of BBa_E1010: Has no possible internal priming sites between this BioBrick part and the VF2 or the VR primer.

The 2018 Hawaii iGEM team evaluated the 40 most frequently used BioBricks and ran them through an internal priming screening process that we developed using the BLAST program tool. Out of the 40 BioBricks we evaluated, 10 of them showed possible internal priming of either the VF2 or VR primers and sometime even both. The data set has a range of sequence lengths from as small as 12 bases to as large as 1,210 bases. We experienced the issue of possible internal priming during the sequence verification process of our own BBa_K2574001 BioBrick and in the cloning process to express the part as a fusion protein. BBa_K2574001 is a composite part containing a VLP forming Gag protein sequence attached to a frequently used RFP part (BBa_E1010). We conducted a PCR amplification of the Gag-RFP insert using the VF2 and VR primers on the ligation product (pSB1C3 ligated to the Gag + RFP). This amplicon would serve as template for another PCR where we would add the NcoI and BamHI restriction enzyme sites through new primers for ligation into pET14b and subsequent induced expression. Despite gel confirming a rather large, approximately 2.1 kb insert band, our sequencing results with the VR primer and BamHI RFP reverse primer gave mixed results. Both should have displayed the end of the RFP, but the VR primer revealed the end of the Gag. Analysis of the VR primer on the Gag-RFP sequence revealed several sites where the VR primer could have annealed with ~9 - 12 bp of complementarity. Internal priming of forward and reverse primers can be detrimental to an iGEM project because you can never be sure if the desired construct was correctly inserted into the BioBrick plasmid without a successful sequence verification.


Contribution

Group: NAU-CHINA iGEM 2020
Summary: In order to better and more comprehensive understand our favorite reporter whose name is BBa_E1010, this year NAU-CHINA uses SWISS MODEL(https://swissmodel.expasy.org) to model and simulates the tertiary structure of protein. We hope that the prediction of the structure will help other teams to better understand the nature and characteristics of this part and be able to use the reporter gene more skillfully.

The following model was built:

Fig.5. Model #01

Fig.6. the Active center

Fig.7. Local Quality Estimate

Fig.8. Comparison with Non-redundant Set of PBD Structures

Contribution

Group: USAFA iGEM 2019
Summary: We have characterized the fluoresence of this part over time and at different temperatures in order to determine optimal incubation conditions and times for best mRFP expression. Our results indicate that 37 degrees C is optimal for both growth and mRFP expression. At 12 hours of incubation at 37C, the RFP was detectable, but after 24 and 48 hours, the expression was much more robust.

mRFP fluorescence.
Figure 1. Quantification of mRFP expression at different incubation temperatures


mRFP fluorescence.
Figure 2. Picture of visible mRFP expression at different incubation times


Conclusion: BBaE1010 is a strong reporter that has RFP expression that can be detected with a fluorescent plate reader or visualized by the unaided eye. 37C was the optimal growth temperature for E. coli expressing the BBaE1010 mRFP and the expression/detection of the mRFP increased over time with 48 hours showing the most robust red color.

Pre-experiment

E. coli Nissle 1917 strains were grown overnight in Lysogeny Broth (LB) containing ampicilin (100 µg/mL) at 37°C and 200 rpm. Cultures were diluted in fresh LB until achieve 0,1 OD with the corresponding antibiotic and transferred to a 96-well plate (50 µL/well). Samples were always made in triplicates and a blank of LB. During 8h the absorbance at OD600 and fluorescence (excitation 488 nm and emission 530 nm) were measured with intervals of 1 hour.


Contribution

Group: USAFA iGEM 2019
Summary: We have characterized the fluoresence of this part over time and at different temperatures in order to determine optimal incubation conditions and times for best mRFP expression. Our results indicate that 37 degrees C is optimal for both growth and mRFP expression. At 12 hours of incubation at 37C, the RFP was detectable, but after 24 and 48 hours, the expression was much more robust.

mRFP fluorescence.
Figure 1. Quantification of mRFP expression at different incubation temperatures


mRFP fluorescence.
Figure 2. Picture of visible mRFP expression at different incubation times


Conclusion: BBaE1010 is a strong reporter that has RFP expression that can be detected with a fluorescent plate reader or visualized by the unaided eye. 37C was the optimal growth temperature for E. coli expressing the BBaE1010 mRFP and the expression/detection of the mRFP increased over time with 48 hours showing the most robust red color.

Contribution

Group:NAU_CHINA 2019
Summary: We measured the fluorescence signal of mRFP in buffer under different pH values and temperatures.
Report genes are essential for every team to construct genetic pathways. We believe that every team has a J04450 complex. After all, it is our favorite report gene!
This year, the NAU iGEM characterized E1010. Based on the work of the previous team work, we explored the tolerance of E1010 expression products at different pH values and temperatures.

Pre-experiment

We dispensed a small amount of the sample into 12 PCR tubes, and a gradient test at 65-95℃ was conducted in a PCR machine for 10 minutes.
We found that the protein samples showed significant denaturation when the temperature was higher than 75℃. So, we set the experimental temperature later at and above 75℃.
The purified sample was dispensed into four PCR tubes and the pH was) adjusted to 4.0, 8.0, 10.28, respectively.
Under each pH value, we dispensed each sample into 12 PCR tubes(50uL sample + 50uL buffer), and a gradient test at 75-95℃ was conducted in a PCR machine for 10 minutes.
We measured the fluorescence intensity of the product under the microplate reader (excitation wavelength was 584 nm, and absorption wavelength was 611 nm).

Analysis

The results show that the product of J04450 begins to show significant denaturation at 84.4℃, and the fluorescence value of the protein no longer changes significantly at the temperature of around 92.5℃, which means E1010 product is completely denatured (shown in our characterization map with a small amount of protein precipitation and the color is pale yellow).
The temperature (from 75.4℃ to 90.3℃) and fluorescence values show a significant linear relationship .
At the same temperature, the pH=4.0 and pH=8.0 curves were basically consistent. The stability of the E1010 expression products at these two pH values was significantly better than that under the condition of pH=10.28.

Discussion

Report genes are required for the construction of most gene pathways. In the future iGEM journey, other teams and we may use some bacteria, like thermophiles, that grow in extreme conditions. We hope we can still use our familiar report gene in these bacteria to detect protein secretion and other related circumstances, so we conducted these tests.
We simulated the extreme environments in which we released the expression products to the extracellular—acid, weak acid, alkaline, and high temperatures—by adjusting the temperature gradients and pH values.
We hope that our experimental results can provide other teams with a reference for the stability of report gene expression products in extreme environments.

Reference

[1] Sudhagar S A , Prasad K P , Makesh M , et al. Characterization and production of polyclonal antisera against pangasius (Pangasianodon hypophthalmus) serum immunoglobulin IgM derived from DEAE cellulose based ion exchange chromatography[J]. Aquaculture Research, 2015, 46(6):1417-1425.

Contribution

Group: Hong_Kong_LFC_PC 2019
Summary: We designed a uric-acid-sensitive uricase generator for treating the gout disease. Since we will use the fluorescence protein to track the gene expression of the device, we would like to check the effect of uric acid on the signal of this E1010 RFP. Since uric acid can alter the pH value, it may interfere the folding of RFP and lower its fluorescence signal. We treat the extracted RFP with different concentration of uric acid, and found that uric acid has a very little effect on the fluorescence signal. This indicate that our system is possible to track the gene expression.
T--Hong_Kong_LFC_PC--rFP2.jpg


Contribution

Group: Valencia_UPV iGEM 2018
Author: Adrián Requena Gutiérrez, Carolina Ropero
Summary: We have adapted the part to be able to assemble transcriptional units with the Golden Gate method and we have done the characterization of this protein.
Documentation:
Part BBa_K2656014 is the monomeric Red Fluorescent Protein 1 coding sequence BBa_E1010 adapted into the [http://2018.igem.org/Team:Valencia_UPV/Design Golden Braid assembly method]. Thus, this sequence is both compatible with the BioBrick and GoldenBraid 3.0. grammar.

This coding sequence can be combined with other Golden Braid compatible parts from our [http://2018.igem.org/Team:Valencia_UPV/Part_Collection Valencia UPV IGEM 2018 Printeria Collection] to assemble transcriptional units in a one-step BsaI reaction with the [http://2018.igem.org/Team:Valencia_UPV/Protocols Golden Gate assembly protocol].

The characterization of this protein (and by extension of all the other part that codify for the mRFP1) was performed with our transcriptional unit BBa_K2656109. This transcriptional unit was assembled in a GoldenBraid alpha1 plasmid including the following parts:

  • BBa_K2656004: the J23106 promoter in its Golden Braid compatible version from our [http://2018.igem.org/Team:Valencia_UPV/Part_Collection Part Collection]
  • BBa_K2656009: the B0030 ribosome biding site in its Golden Braid compatible version from our [http://2018.igem.org/Team:Valencia_UPV/Part_Collection Part Collection]
  • BBa_K2656014: coding sequence
  • BBa_K2656026: the B0015 transcriptional terminator in its Golden Braid compatible version from our [http://2018.igem.org/Team:Valencia_UPV/Part_Collection Part Collection]

In order to carry out a correct characterization of the protein and to be able to use it to make measurements of the different transcriptional units that we assembled with it, we obtained the emission and excitation spectra in the conditions of our equipment. By using this protocol [http://2018.igem.org/Team:Valencia_UPV/Experiments#spectra] with the parameters of Table 1, Figure 1 was obtained.


Parameter Value
Number of samples 3
Excitation Wavelength measurement range 1 (nm) [450-620]
Excitation Wavelength measurement range 2 (nm) [620-700]
Emission wavelenght 1 (nm) 650
Emission wavelenght 2 (nm) 590
Emission Wavelength measurement range (nm) [565-700]
Excitation wavelenght (nm) 540
Gain (G) 70
Table 1. Parameters used to obtain the spectra


mRFP spectra.
Figure 1. mRFP emission and excitation spectra


Contribution

Group: Hong Kong-CUHK iGEM 2017
Author: Yuet Ching Lin
Summary: We measured the fluorescent signal of mRFP in buffers with different pH.
Documentation:
Charaterization of mRFP pH stabillity:

We grew C41 bacteria with parts BBa_J61002 in 2XYT for 24 hours. After purifying the mRFP by Ion Exchange Chromatography and Hydrophobic Interaction Chromatography, we measured the fluoresece (ex ,em ) of purified mRFP, which is diluted to 10µg/100µl (total 200µl) in triplicates, into different buffers (ranges from pH2 to pH12; Volume of mRFP:buffer = 1:1.8). To facilitate reproducibility of the experiment, we correlated the relative fluorescent intensity to an absolute fluorophore concentration by referring it to a standard curve of the fluorophores(Rhodamine) using the interlab study protocol. The result shows that the stability drops dramatically in pH condition below 6 and relatively stable in pH 6-10.

Fig.1 Vary pH attributed to different fluorescent intensity of RFP.

Table 1 Plate reader setting of fluorescent measurement

Measurement Type Fluorescence
Microplate name COSTAR 96
Scan mode orbital averaging
Scan diameter [nm] 3
Excitation 550-20
Emission 605-40
Dichronic filter auto 572.5
Gain 500
Focal height [nm] 9


Contribution2

Part name:BBa_K2382013
Group: iGEM17_CSMU_NCHU_Taiwan 2017
Author: SHAO-CHI LO
Summary: We add a His Tag at the end. Therefore, a fusion protein with this part may have red color and the ability to be purified easily.






Documentation:

Sequence and Features


Barcodes are discontinued, but one was appended to the sequence of this part. Composite parts using this part will include the barcode. More ...

Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    INCOMPATIBLE WITH RFC[25]
    Illegal AgeI site found at 555
    Illegal AgeI site found at 667
  • 1000
    COMPATIBLE WITH RFC[1000]


;

Parts table

Protein data table for BioBrick BBa_E1010 automatically created by the BioBrick-AutoAnnotator version 1.0
Nucleotide sequence in RFC 10: (underlined part encodes the protein)
 ATGGCTTCC ... ACCGGTGCTTAATAACGCTGATAGTGCTAGTGTAGATCGC
 ORF from nucleotide position 1 to 675 (excluding stop-codon)
Amino acid sequence: (RFC 25 scars in shown in bold, other sequence features underlined; both given below)

101 
201 
MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFE
DGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLD
ITSHNEDYTIVEQYERAEGRHSTGA*
Sequence features: (with their position in the amino acid sequence, see the list of supported features)
None of the supported features appeared in the sequence
Amino acid composition:
Ala (A)12 (5.3%)
Arg (R)9 (4.0%)
Asn (N)4 (1.8%)
Asp (D)14 (6.2%)
Cys (C)0 (0.0%)
Gln (Q)8 (3.6%)
Glu (E)22 (9.8%)
Gly (G)23 (10.2%)
His (H)5 (2.2%)
Ile (I)9 (4.0%)
Leu (L)12 (5.3%)
Lys (K)22 (9.8%)
Met (M)9 (4.0%)
Phe (F)10 (4.4%)
Pro (P)12 (5.3%)
Ser (S)12 (5.3%)
Thr (T)14 (6.2%)
Trp (W)3 (1.3%)
Tyr (Y)11 (4.9%)
Val (V)14 (6.2%)
Amino acid counting
Total number:225
Positively charged (Arg+Lys):31 (13.8%)
Negatively charged (Asp+Glu):36 (16.0%)
Aromatic (Phe+His+Try+Tyr):29 (12.9%)
Biochemical parameters
Atomic composition:C1135H1749N299O347S9
Molecular mass [Da]:25423.7
Theoretical pI:5.65
Extinction coefficient at 280 nm [M-1 cm-1]:32890 / 32890 (all Cys red/ox)
Plot for hydrophobicity, charge, predicted secondary structure, solvent accessability, transmembrane helices and disulfid bridges 
Codon usage
Organism:E. coliB. subtilisS. cerevisiaeA. thalianaP. patensMammals
Codon quality (CAI):excellent (0.84)good (0.72)good (0.68)good (0.74)good (0.78)good (0.71)
Alignments (obtained from PredictProtein.org)
SwissProt:Q9U6Y8 (86% identity on 221 AAs), P83690 (63% identity on 215 AAs)
TrEML:Q5S3G8 (95% identity on 225 AAs), D0VWW2 (94% identity on 220 AAs)
PDB:2h5q (94% identity on 216 AAs), 2qlg (94% identity on 215 AAs)
Predictions (obtained from PredictProtein.org)
Subcellular Localization (reliability in brackets)
Archaea:secreted (100%)
Bacteria:cytosol (52%)
Eukarya:cytosol (20%)
Gene Ontology (reliability in brackets)
Molecular Function Ontology: -
Biological Process Ontology:GO:0018298 (40%), GO:0008218 (27%)
 
Predicted features:
Disulfid bridges: -
Transmembrane helices: -
The BioBrick-AutoAnnotator was created by TU-Munich 2013 iGEM team. For more information please see the documentation.
If you have any questions, comments or suggestions, please leave us a comment.


Functional Parameters: Austin_UTexas

BBa_E1010 parameters

Burden Imposed by this Part:

Burden Value: -1.1 ± 2.5%

Burden is the percent reduction in the growth rate of E. coli cells transformed with a plasmid containing this BioBrick (± values are 95% confidence limits). This BioBrick did not exhibit a burden that was significantly greater than zero (i.e., it appears to have little to no impact on growth). Therefore, users can depend on this part to remain stable for many bacterial cell divisions and in large culture volumes. Refer to any one of the BBa_K3174002 - BBa_K3174007 pages for more information on the methods, an explanation of the sources of burden, and other conclusions from a large-scale measurement project conducted by the 2019 Austin_UTexas team.

This functional parameter was added by the 2020 Austin_UTexas team.

CSMU_Taiwan 2020 Contribution

Group: CSMU iGEM 2020
Author: Huan-Jui Chang, Cheng-Ruei Yang, Hung-Yu Chen

Introduction

This year, our project aims to detect oral cancer. So, we test many reporter proteins at the beginning, one of them is mRFP. To develop an oral cancer detection device, we are curious about how the pH condition in biological samples can affect the expression levels of PURExpress in vitro protein synthesis reactions. We didn't adopt mRFP as our expression protein, but we regard the test about pH effecting on mRFP as helpful information to other teams, so we present it on our wiki. We use BBa_K199118 1,2 as one of our candidate reporter genes. This part is composed of T7 promoter + RBS + mRFP, which produces red fluorescent protein. We found out that different pH level interferes with the reporter proteins since different pH level could change the folding and structure3,4. Thus, we want to know how pH values affect mRFP. We added mRFP produced in vitro and different pH buffers, including pH 2, pH 5, pH 7, pH8, pH 10, pH12, into a 384-well plate. Then, we measure the excitation and emission spectrum and observe the different characteristics of them.

Method

We expressed mRFP through the addition of T7 terminator on an existing part BBa_K199118 so that the new part (BBa_K3431048) can be expressed through our modified PURExpress in vitro protein synthesis kit (for further inquiries, please refer to our Measurement page). We reproduced the conditions of pH 2, pH 5, pH 7, pH8, pH 10, and pH12 by mixing different chemical compounds in double-distilled water. After expressing mRFP through the kit, we measured its excitation and emission spectra with a Synergy H1 microplate reader. We performed our data analysis and presentation through GraphPad Prism 5. For further interests, the procedures for this experiment can be found at our Protocol page.


Results



Figure 1. In this graph, we can find that when the pH value drops, the Fluorescent Intensity of mRFP also decreases correspondingly. In pH12, mRFP has the highest Fluorescent Intensity while it approaches zero when pH value becomes value 2. From our result, we could found that mRFP has stronger signals in alkaline environments, and the signal depletes over 50% once the pH value drops below 5.



Figure 2. In the emission graph above, we can observe that the trend of fluorescent intensity is similar to the excitation graph. To the peak wavelength, we observe both the excitation graph and emission graph and point out their peak in different pH values. Regardless of pH2 since its intensity is quite weak, there is little difference between each pH value, only the absorbance wavelength of pH12 is lower than other pH values in both graph That is to say, if we want to use mRFP as our final product, we can make an alkaline environment to gain the most obvious results. However, we need to lower our emission and excitation wavelengths when we set up our plate reader.

Reference

1. Battad, J. M., Wilmann, P. G., Olsen, S., Byres, E., Smith, S. C., Dove, S. G., Turcic, K. N., Devenish, R. J., Rossjohn, J., & Prescott, M. (2007). A structural basis for the pH-dependent increase in fluorescence efficiency of chromoproteins. Journal of molecular biology, 368(4), 998–1010. [1](https://doi.org/10.1016/j.jmb.2007.02.007)

2. T7 promoter + RBS + mRFP [2](https://parts.igem.org/Part:BBa_K199118)

3. mRFP[3](https://parts.igem.org/Part:BBa_E1010)

4. Johnson, D. E., Ai, H. W., Wong, P., Young, J. D., Campbell, R. E., & Casey, J. R. (2009). Red fluorescent protein pH biosensor to detect concentrative nucleoside transport. The Journal of biological chemistry, 284(31), 20499–20511. [4](https://doi.org/10.1074/jbc.M109.019042)

[edit]
Categories
//chassis/prokaryote/bsubtilis
//chassis/prokaryote/ecoli
//function/reporter
//function/reporter/fluorescence
//test
Parameters
abs
biology
colorRed
directionForward
emission607
emit607
excitation584
excite584
kegg
lum
proteinmRFP1
swisspro
tagNone