Lac-S100-1
protein sequence:
MKVQRRVYRFRILNASISRSFRPTLSTGEPVHIVATDGGLMPKTQSVESWRHAGAERYEILVDFSAYQPGQRVELRNLSNKNNVDYDFTDRIMAFDVTDQPVDTTDHTWNTIPQTLANHEVMDLRPTRDTRVRKFEVKRNDSVWVIGEDSWADIIASGYRRVCADPDLGAQEIWEFENSSGGWFHPIHIHLVDFQILSRNGRAPFSYEMGPKDVVYVGEGETVRLLMKFGPHRGKYMIHCHNLPHEDHDMMTQFSVGLKPGEVDLNDPMKAAPAFWDGD
plasmid mapping:
PCR gel charts:
注:M:Marker,2000 bp;Line22:Lac-S100-1(660 bp)
Results of Western Blot:
M: Marker; C: CK; Line5: Lac-S100-1, 32.07kDa
Loss of weight (rate of degradation of original membrane weight, etc.):0.760%
Line1: CK; Line9: Lac-S100-1;
Polyethylene film weight loss (0.01 < P < 0.05 labelled *, 0.001 < P <0.01 labelled **, P < 0.001 labelled ***, P > 0.05 indicates no statistical significance labelled ns)
scanning electron microscope image:
Fourier diagram:
Plastic Film(Carbonyl index(CI):3.63%)
Plastic Microspheres(Carbonyl index(CI):6.08%)