Part:BBa_K4127021
Cas12a Protein Plasmid
Under the cooperation discussion, our partner NUDT_CHINA helped us design the expression plasmid of Cas12a protein
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21INCOMPATIBLE WITH RFC[21]Illegal BglII site found at 1147
Illegal BglII site found at 1768
Illegal BglII site found at 2035
Illegal BglII site found at 2605
Illegal BglII site found at 2938
Illegal BglII site found at 4129
Illegal BamHI site found at 3942
Illegal XhoI site found at 158 - 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 1175
Illegal NgoMIV site found at 1877
Illegal NgoMIV site found at 2876
Illegal NgoMIV site found at 4161
Illegal NgoMIV site found at 5749
Illegal NgoMIV site found at 5909
Illegal NgoMIV site found at 8956 - 1000INCOMPATIBLE WITH RFC[1000]Illegal BsaI site found at 1901
Illegal BsaI site found at 2261
Illegal BsaI site found at 2441
Illegal BsaI site found at 3503
Illegal SapI site found at 995
Illegal SapI site found at 1615
Illegal SapI site found at 1635
Illegal SapI site found at 2486
Illegal SapI site found at 2546
Illegal SapI site found at 6829
Source:
The Echinococcus characteristic sequences, 70 to 90 bp in length, are from the Echinococcus genome.
1.Expression vector and resistance
pET-28a(Kanamycin)
2.plasmid profile
3.Complete sequence of the target protein
>LbCpf1
MSKLEKFTNCYSLSKTLRFKAIPVGKTQENIDNKRLLVEDEKRAEDYKGVKKLLDRYYLSFINDVLHSIKLKNLNNYI
SLFRKKTRTEKENKELENLEINLRKEIAKAFKGNEGYKSLFKKDIIETILPEFLDDKDEIALVNSFNGFTTAFTGFFDNRE
NMFSEEAKSTSIAFRCINENLTRYISNMDIFEKVDAIFDKHEVQEIKEKILNSDYDVEDFFEGEFFNFVLTQEGIDVYN
AIIGGFVTESGEKIKGLNEYINLYNQKTKQKLPKFKPLYKQVLSDRESLSFYGEGYTSDEEVLEVFRNTLNKNSEIFSSI
KKLEKLFKNFDEYSSAGIFVKNGPAISTISKDIFGEWNVIRDKWNAEYDDIHLKKKAVVTEKYEDDRRKSFKKIGSFS
LEQLQEYADADLSVVEKLKEIIIQKVDEIYKVYGSSEKLFDADFVLEKSLKKNDAVVAIMKDLLDSVKSFENYIKAFF
GEGKETNRDESFYGDFVLAYDILLKVDHIYDAIRNYVTQKPYSKDKFKLYFQNPQFMGGWDKDKETDYRATILRY
GSKYYLAIMDKKYAKCLQKIDKDDVNGNYEKINYKLLPGPNKMLPKVFFSKKWMAYYNPSEDIQKIYKNGTFKKG
DMFNLNDCHKLIDFFKDSISRYPKWSNAYDFNFSETEKYKDIAGFYREVEEQGYKVSFESASKKEVDKLVEEGKLY
MFQIYNKDFSDKSHGTPNLHTMYFKLLFDENNHGQIRLSGGAELFMRRASLKKEELVVHPANSPIANKNPDNPK
KTTTLSYDVYKDKRFSEDQYELHIPIAINKCPKNIFKINTEVRVLLKHDDNPYVIGIDRGERNLLYIVVVDGKGNIVE
QYSLNEIINNFNGIRIKTDYHSLLDKKEKERFEARQNWTSIENIKELKAGYISQVVHKICELVEKYDAVIALEDLNSGF
KNSRVKVEKQVYQKFEKMLIDKLNYMVDKKSNPCATGGALKGYQITNKFESFKSMSTQNGFIFYIPAWLTSKIDP
STGFVNLLKTKYTSIADSKKFISSFDRIMYVPEEDLFEFALDYKNFSRTDADYIKKWKLYSYGNRIRIFRNPKKNNVF
DWEEVCLTSAYKELFNKYGINYQQGDIRALLCEQSDKAFYSSFMALMSLMLQMRNSITGRTDVDFLISPVKNSD
GIFYDSRNYEAQENAILPKNADANGAYNIARKVLWAIGQFKKAEDEKLDKVKIAISNKEWLEYAQTSVKH
4.Expression and purification strategies
⚫ Cas12a expression plasmids were transformed into E. coli BL21 (DE3) (Table S5).
⚫ For protein expression, a single clone was first cultured overnight in 5-mL liquid LB tubes and then 1% (v/v) inoculated into 3 L of fresh liquid LB. Cells were grown with shaking at 220 rpm and 37 °C until the OD600 reached 0.8, and IPTG was then added to a final concentration of 0.2 mM followed by further culture of the cells at 16 °C for about 16 h before the cell harvesting.
⚫ Cells were resuspended in 50 mL of lysis buffer [50 mM Tris-HCl (pH 8.0), 1.5 M NaCl, 1 mM DTT and 5% glycerol] with 1 mM PMSF as the protease inhibitor and lysed by high pressure.
⚫ The obtained lysate was then centrifuged twice at 15,000 rpm for 30 min. After centrifuging, the supernatant was mixed with 5 mL of Ni-NTA beads (GE Healthcare) and softly shaken for 1 h at 4 °C before being loaded onto a 30-mL column.
⚫ The packing was then washed with wash buffer (lysis buffer supplemented with 30 mM imidazole) and eluted with elution buffer (lysis buffer supplemented with 600 mM imidazole). The elution was dialysed with dialysis buffer 1 [50 mM Tris-HCl (pH 8.0), 200 mM NaCl, 1 mM DTT and 5% glycerol].
⚫ Before the protein solution was loaded onto an anion exchange column (HiTrapTM Q HP, GE Healthcare), it was diluted until the final NaCl concentration reached below 80 mM. After that, the column was washed and then eluted with a gradient concentration of NaCl (AKTA Pure, GE Healthcare).
⚫ Fractions containing Cas12a proteins were verified by SDS-PAGE and then pooled for dialysis with dialysis buffer 2 [20 mM Tris-HCl (pH 8.0), 600 mM NaCl, 2 mM DTT, 0.2 mM EDTA] overnight.
⚫ Finally, the protein was collected and diluted to a final concentration of 6 μM and mixed with an equal volume of 100% cold glycerol prior to being frozen at −80 °C.
None |