Part:BBa_K1640012
psbQR
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21INCOMPATIBLE WITH RFC[21]Illegal BglII site found at 451
Illegal BglII site found at 780 - 23COMPATIBLE WITH RFC[23]
- 25COMPATIBLE WITH RFC[25]
- 1000INCOMPATIBLE WITH RFC[1000]Illegal BsaI site found at 844
Overview
This biobrick contains two genes from the photosystem II complex of Chlamydomonas reinhardtii - psbQ and psbR, with RBS preceeding each gene.
- psbQ is Oxygen-evolving enhancer protein 3 - psbR is a 10 kDa photosystem II polypeptide
This part was designed in conjunction with BBa_K1640022, and BBa_K1640023, and together they form operon 5 in our set of photosystem II operons:
Biology & Literature
The psbQ gene encodes a 17 kDa protein that is located on the inner side of the thylakoid lumen. Its N-terminus region contains a polyproline II helix (Balsera, M., et al., 2005). It plays an important role in the ability of photosystem II to function in low light conditions (Yi, X., et al., 2006). Studies involving mutant cells have shown that, in the absence of psbQ, their ability to generate oxygen is impaired and psbV is destabilised (Kashino, Y., et al., 2006).
The psbR gene encodes a 10 kDA protein that is essential to the stable assembly of psbP, which is a component of the oxygen-evolving complex of photosystem II. The assembly of psbR is mediated by psbJ (Suorsa, M., et al., 2006). Electron transport in both the donor and the acceptor side of the photosystem II core complex are modified in the absence of this protein (Allahverdiyeva, Y., et al., 2007).
Protein information
psbQ
mass: 19.6kDa
sequence:
MASGESRRAVLGGLLASAVAAVAPKAALALTPVDLFDDRSVRDRGFDLIYEARDLDLPQNVREGFTQARASL
DETKKRVKESEARIDADLDVFIQKSYWTEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVE
DLDFALREKDQASAAKKLEITKAKLDSVLAAVL
psbR
mass: 12.2kDa
sequence:
MGGGKTDITKVGLNSIEDPVVKQNLMGKSRFMNKKDWKDASGRKGKGYGVYRYEDKYGANVDGYSPIYTPDL
WTESGDSYTLGTKGLIAWAGLVLVLLAVGVNLIISTSQLGA
References
Allahverdiyeva, Y., Mamedov, F., Suorsa, M., Styring, S., Vass, I., & Aro, E. M. (2007). Insights into the function of PsbR protein in Arabidopsis thaliana. Biochimica et Biophysica Acta (BBA)-Bioenergetics, 1767(6), 677-685.
Balsera, M., Arellano, J. B., Revuelta, J. L., De las Rivas, J., & Hermoso, J. A. (2005). The 1.49 Å resolution crystal structure of PsbQ from photosystem II of Spinacia oleracea reveals a PPII structure in the N-terminal region. Journal of molecular biology, 350(5), 1051-1060.
Kashino, Y., Inoue-Kashino, N., Roose, J. L., & Pakrasi, H. B. (2006). Absence of the PsbQ protein results in destabilization of the PsbV protein and decreased oxygen evolution activity in cyanobacterial photosystem II. Journal of Biological Chemistry, 281(30), 20834-20841.
Suorsa, M., Sirpiö, S., Allahverdiyeva, Y., Paakkarinen, V., Mamedov, F., Styring, S., & Aro, E. M. (2006). PsbR, a missing link in the assembly of the oxygen-evolving complex of plant photosystem II. Journal of Biological Chemistry, 281(1), 145-150.
Yi, X., Hargett, S. R., Frankel, L. K., & Bricker, T. M. (2006). The PsbQ protein is required in Arabidopsis for photosystem II assembly/stability and photoautotrophy under low light conditions. Journal of Biological Chemistry, 281(36), 26260-26267.
None |