Signalling
Part:BBa_K1978002
Designed by: Gregor Hoffmann Group: iGEM16_Goettingen (2016-10-14)
TorA-RFP
The TorA-RFP BioBrick consists of a TorA signal linked to RFP, which is fluorescent protein. The TorA signal sequence allows export of fully-folded proteins through the inner membrane via the TAT(Twin-Arginin Translocation) system. This enables export of RFP out of the cell. The TorA sequence codes for a peptide that harbours a twin-arginine motif. This is vital for the recognition by the Tat system. Moreover, an AxA motif is present, which leads to cleavage by the leader peptidase I (Palmer & Berks 2012). MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA
Usage and Biology
This BioBrick can be used to test a new organism for compatibility with BioBricks using the standart torA signal sequence from E. coli. -->
[edit]
Categories
Parameters
None |