Coding
ChimeraII

Part:BBa_K4179012

Designed by: Yasmin Habib   Group: iGEM22_Technion-Israel   (2022-10-05)
Revision as of 15:26, 6 October 2022 by Amitn (Talk | contribs)


PT1a with the donor docking domain switched to the domain of G4DT

PDB file of UbiA of chimeraI was created with Phyre2 and visualized in ChimeraX[11]
.
Docking of prenyl with chimeraI as viewed in Dockthor
.


This sequence codes for a prenyl transferase - PT1a[1], with the donor docking domain switched to the domain of G4DT[1]. This enzyme should catalyze the formation of DMS from umbelliferone.

Origin

PT1a – Citrus limon G4DT – Glycine max


Prenylation

Prenylation is a structural modification in which an isoprenoid moiety, prenyl being the most common, is transferred from a donor molecule to an acceptor. Prenylation of aromatic substrates causes the enhancement of their bioactivity which is a crucial step in the biosynthesis of biologically active secondary metabolites, which are important in the survival and disease resistance of many plant species. To perform prenylation, plants use membrane-bound aromatic prenyltransferases (PTs) that transfer isoprenoid moieties from pyrophosphate donor substrates to aromatic acceptor substrates [2].


Motivation for creating chimera enzyme

PT1a is a prenyltransferase that originated from Citrus limon and was expressed in yeast[2]. This prompted us to attempt expressing it in bacteria. This enzyme uses the desired acceptor but not the desired donor. G4DT is a prenyltransferase that uses the desired donor but not the desired acceptor. In this part, we switched the PT1a domain responsible for binding the donor molecule with the equivalent domain of G4DT.

Identifying the UbiA domain in each enzyme

We decided to identify the site that is responsible for the prenylation reaction and change it so it will use the correct donor. We hypothesized that this switch will enable the bacteria to express the enzyme while changing the donor molecule – giving our desired reaction. UbiA is a domain shared by a family of prenyltransferases – each catalyzing prenylation reaction[3]. For that reason, we deduced that this is the domain we should target. We used the Pfam database[4] to find the amino acids positions consisting of the UbiA domain.

Identifying donor docking domain

We then turned to identify the specific site responsible for donor docking. We found 2 other enzymes that were expressed in yeast[5,6] and uses the correct donor (with the wrong substrate) – G4DT originated from Humulus lupulus[1] and PT1L originated from Glycine max[1]. We again located the UbiA domains and used blast[7] to compare the 2 sequences expecting to find homology (because of the shared donor). We found a site consisting of 16 amino acids having high homology. We also noticed that the motif we found has 2 aspartates in the middle of it. We further noticed the presence of aspartates in other UbiA domains in other enzymes. It looked significant so we reviewed the literature and found out that aspartates are crucial for the action of the prenyltransferase as they interact with Mg2+ which is a cofactor for the enzyme[8]. All of the above led us to believe we identified the motif responsible for binding the desired donor (dimethylallyl diphosphate). To identify the site in the lemon enzyme responsible for binding the geranyl diphosphate we used blast to compare the UbiA of PT1a and (PcPT). We saw several homologies but searched for a sequence containing aspartates. We found a smaller homologous sequence – which we predicted because the two enzymes have different donors. We then assumed that the motif size should be 16 amino acids long and identified the site to be the homologous part (10 amino acids) plus the upstream 6 amino acids.



Partial results of blastn between the UbiA domains of PT1L and G4DT

Score:119 bits(297), Expect:9e-37, Method: Compositional matrix adjust., Identities:88/274(32%), Positives:144/274(52%), Gaps:17/274(6%)

Query 5 CAFSSSLLAVEKLSDISLSFLIGVLQGVLPQLFIEIYLCGVNQLYDLEIDKINKPHLPMA 64

           C F   LL  E  +  S   +   L G+L  L    Y  G+NQ++D++ID+INKP LP+ 

Sbjct 5 CLFGRELL--ENPNLFSWPLIFRALLGMLAILGSCFYTAGINQIFDMDIDRINKPDLPLV 62 Partial results of blastn between the UbiA domains of PcPT and PT1a Score: 253 bits(646), Expect:7e-89, Method: Compositional matrix adjust., Identities:130/272(48%), Positives:181/272(66%), Gaps:1/272(0%)

Query 3 IGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDKVNKP 62

           I TI+GI+S+++LPL S AD +P YF+  L+AL+  +  N Y   +NQ+ DV+IDK+NKP

Sbjct 2 ICTIIGISSVSLLPLTSVADFSPAYFVGLLQALIPFLCANIYTSAINQLVDVDIDKINKP 61

Query 63 GLPLASGDLSVGTGLAITLILSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLPFLRW 122

            LPL SG+ S+G G AI   L+ T  A+A+   S PL  G++V+FL+GTAYSV+ P LRW

Sbjct 62 YLPLVSGEFSMGEGRAIVSALTFTCFAMAIMSHSVPLFVGVLVYFLIGTAYSVEHPLLRW 121

Domain switch

We switched between the identified sites to create a chimera enzyme. We validated the folding of our enzymes using Phyre2[9] and tested the chimeras' capability to bind dimethylallyl diphosphate using Dockthor[10]. The results showed that our chimeras bind the prenyl group even better than the original enzyme bind the geranyl group!

Dockthor results

| enzyme | ligand | best total energy | |------------------------|----------------|----------------------------| | original (PT1a) | geranyl | -45.526 | | Chimera I | prenyl | -66.706 | | Chimera II | prenyl | -73.116 |



The team of Technion 2022 used this part in a construct (BBa_K4179014) designed for the purpose of introducing decursin’s biosynthetic pathway into E. coli. The team’s starting point was umbelliferone, which had to be prenylated to yield DMS. and thus, this enzyme was needed to perform the first reaction in the pathway.




Sequence and Features


Assembly Compatibility:
  • 10
    INCOMPATIBLE WITH RFC[10]
    Illegal PstI site found at 634
  • 12
    INCOMPATIBLE WITH RFC[12]
    Illegal NheI site found at 1213
    Illegal PstI site found at 634
  • 21
    INCOMPATIBLE WITH RFC[21]
    Illegal BglII site found at 699
  • 23
    INCOMPATIBLE WITH RFC[23]
    Illegal PstI site found at 634
  • 25
    INCOMPATIBLE WITH RFC[25]
    Illegal PstI site found at 634
    Illegal NgoMIV site found at 739
  • 1000
    COMPATIBLE WITH RFC[1000]


This part includes the gene of ChimeraI, in addition to two restriction sites, one at every end of the gene. NdeI restriction site was added to the N-terminus side of the sequence, directly before the methionine codon of the ChimeraI gene. NheI restriction site was added to the C-terminus side of the sequence, directly after the end of the gene.

A stop codon is not present at the end of the ChimeraI gene, due to the gene being cloned upstream to a P2A (BBa_K4179005)-mCherry(BBa_K106005)sequence. In this genetic system (BBa_K4179014) , the mCherry expression is tied directly to the start codon of ChimeraI, while not being covalently bound to it. In such a design the mCherry signal corresponds to a 1:1 ratio, at the very least, which allows for a lower estimate of ChimeraI’s expression.

References

1. Bateman, Alex, et al. “Uniprot: The Universal Protein Knowledgebase in 2021.” Nucleic Acids Research, vol. 49, no. D1, 2020, https://doi.org/10.1093/nar/gkaa1100.

2. Munakata, Ryosuke, et al. “Molecular Cloning and Characterization of a Geranyl Diphosphate-Specific Aromatic Prenyltransferase from Lemon .” Plant Physiology, vol. 166, no. 1, 2014, pp. 80–90., https://doi.org/10.1104/pp.114.246892.

3. Li, Weikai. “Bringing Bioactive Compounds into Membranes: The UbiA Superfamily of Intramembrane Aromatic Prenyltransferases.” Trends in Biochemical Sciences, vol. 41, no. 4, 2016, pp. 356–370., https://doi.org/10.1016/j.tibs.2016.01.007.

4. Mistry, Jaina, et al. “Pfam: The Protein Families Database in 2021.” Nucleic Acids Research, vol. 49, no. D1, 2020, https://doi.org/10.1093/nar/gkaa913.

5. Akashi, Tomoyoshi, et al. “Molecular Cloning and Characterization of a cDNA for Pterocarpan 4-Dimethylallyltransferase Catalyzing the Key Prenylation Step in the Biosynthesis of Glyceollin, a Soybean Phytoalexin .” Plant Physiology, vol. 149, no. 2, 2008, pp. 683–693., https://doi.org/10.1104/pp.108.123679.

6. Li, Haoxun, et al. “A Heteromeric Membrane-Bound Prenyltransferase Complex from Hop Catalyzes Three Sequential Aromatic Prenylations in the Bitter Acid Pathway.” Plant Physiology, vol. 167, no. 3, 2015, pp. 650–659., https://doi.org/10.1104/pp.114.253682.

7. Altschul, Stephen F., et al. “Basic Local Alignment Search Tool.” Journal of Molecular Biology, vol. 215, no. 3, 1990, pp. 403–410., https://doi.org/10.1016/s0022-2836(05)80360-2.

8. Bräuer, Lars, et al. “A Structural Model of the Membrane-Bound Aromatic Prenyltransferase UbiA Frome. Coli.” ChemBioChem, vol. 9, no. 6, 2008, pp. 982–992., https://doi.org/10.1002/cbic.200700575.

9. Kelley, Lawrence A, et al. “The PHYRE2 Web Portal for Protein Modeling, Prediction and Analysis.” Nature Protocols, vol. 10, no. 6, 2015, pp. 845–858., https://doi.org/10.1038/nprot.2015.053.

10. Guedes, Isabella A., et al. “New Machine Learning and Physics-Based Scoring Functions for Drug Discovery.” Scientific Reports, vol. 11, no. 1, 2021, https://doi.org/10.1038/s41598-021-82410-1.

11. Pettersen, Eric F., et al. “UCSF Chimerax: Structure Visualization for Researchers, Educators, and Developers.” Protein Science, vol. 30, no. 1, 2020, pp. 70–82., https://doi.org/10.1002/pro.3943.

[edit]
Categories
Parameters
None