Difference between revisions of "Part:BBa K1362400"
(→Nostoc punctiforme DnaE split intein (NpuDnaE)) |
|||
Line 16: | Line 16: | ||
The sequences above are specified with three native extein residues on each of the termini. Please note that in the case of <i>Npu</i> DnaE these are not the most efficient amino acids in supporting the splicing reaction. Detailed information that we found to be very useful is given in [[{{PAGENAME}}:Design#References|[2]]]. | The sequences above are specified with three native extein residues on each of the termini. Please note that in the case of <i>Npu</i> DnaE these are not the most efficient amino acids in supporting the splicing reaction. Detailed information that we found to be very useful is given in [[{{PAGENAME}}:Design#References|[2]]]. | ||
+ | |||
<!-- Add more about the biology of this part here | <!-- Add more about the biology of this part here | ||
===Usage and Biology=== | ===Usage and Biology=== | ||
− | |||
<span class='h3bb'>Sequence and Features</span> | <span class='h3bb'>Sequence and Features</span> | ||
<partinfo>BBa_K1362400 SequenceAndFeatures</partinfo> | <partinfo>BBa_K1362400 SequenceAndFeatures</partinfo> |
Revision as of 10:56, 19 October 2014
NpuDnaE N-Intein cloning piece
NpuDnaE split Intein, N-terminal half. This is a DNA piece for cloning used to assemble other BioBrick parts.
Nostoc punctiforme DnaE split intein (Npu DnaE)
Inteins can be found in all kingdoms of life, however their use for the organism remains yet unknown. In the past years many intein sequences were found in the genomes of cyanobacteria. Npu DnaE is a naturally split intein from the alpha subunit of Dna Polymerase III in Nostoc punctiforme bacteria which shows [1] extraordinarly high splicing activity and therefore is currently still on of the gold-standards for inteins.
Amino Acid Sequence: N-Intein: AEY | CLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRVDNLPN C-Intein: MIKIATRKYLGKQNVYDIGVERDHNFALKNGFIASN | CFN
The sequences above are specified with three native extein residues on each of the termini. Please note that in the case of Npu DnaE these are not the most efficient amino acids in supporting the splicing reaction. Detailed information that we found to be very useful is given in [2].