Difference between revisions of "Part:BBa K1415006"

 
(105 intermediate revisions by 4 users not shown)
Line 1: Line 1:
 
__NOTOC__
 
__NOTOC__
 
<partinfo>BBa_K1415006 short</partinfo>
 
<partinfo>BBa_K1415006 short</partinfo>
[[File:HAH-insect.png|thumb|right|300px|'''Fig.1-1''' A coding gene of a Spodoptera litura's PBAN ]]
+
 
[[File:HAH.png|right|300px|]]
+
<h1>'''Introduction:''' PBAN (Pheromone Biosynthesis Activating Neuropeptide)</h1>
 +
 
 +
<div>[[File:HAH.png|thumb|right|300px|'''Fig.1-1''' A coding gene of a <span style="font-style: italic;">''Helicoverpa armigera Hubner's''</span> PBAN]]</div>
 +
<p style="font-size:120%">'''Mechanism of PBAN'''</p>
 
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.
 
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.
+
<br><br>
 +
<p style="font-size:120%">'''Features of PBAN'''</p>
 +
'''1. Species-specific''': PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with its specific receptor, resulting in the production of a particular pheromone.
 +
<br><br>
 +
'''2. Small and simple:''' The coding sequence for a PBAN is only around 100 base pairs. For ''E.coli'', 100 base pairs is totally within its working capacity. Therefore, ''E.coli'' can be a low-cost PBAN factory. By transforming the DNA sequences for different PBAN into the ''E.coli'', we can even gain a variety of PBANs.  
 +
<br><br>
 +
'''3. Secreted directly:''' Because PBAN is secreted by the insect itself, the insect would not form a resistance to it compare to use pesticide.
 +
<br><br>
 +
Together, using PBAN is totally a environmental friendly way for solving harmful insects problems with easily triggering pheromone production by contacting with its receptor.
 +
<br><br>
 +
<div style="font: italic bold 12px/30px Georgia, serif;">This part is a coding gene of Helicoverpa armigera Hubner's PBAN.</div>
 +
<br>
 +
See our expanding PBAN (''Helicoverpa armigera Hubner'') parts collection:
 +
[https://parts.igem.org/Part:BBa_K1415106 P<sub>cons</sub>+B0034+PBAN(''Helicoverpa armigera Hubner'')] and
 +
[https://parts.igem.org/Part:BBa_K1415206 P<sub>cons</sub>+B0034+PBAN(''Helicoverpa armigera Hubner'')+B0034+BFP+J61048 ]
  
So,if we ligate the constitutive promoter and ribosome binding site,we can make our E.coli produce our special peptides constantly.
+
[[File:2014NCTUGprotein.jpg|800px|thumb|center|'''Fig.1-2''' Working mechanism of PBAN ]]
 +
''Reference:<p>Ada Rafaeli, Pheromone biosynthesis activating neuropeptide (PBAN): Regulatory role and mode of action, General and Comparative Endocrinology 162 (2009) 69–78.</p>''
 +
<br><br><br>
  
Target insect:Cotton bollworm Helicoverpa armigera &#65288;Hubner&#65289;
+
<h1>'''Target insect:''' Cotton bollworm (''Helicoverpa armigera Hubner'')</h1>
 +
[[File:HAH-insect.png|thumb|right|900px|'''Fig.2-1''' Introduction of ''Helicoverpa armigera Hubner'']]
  
Spread:The pink bollworm has spread to cotton-growing regions throughout the world.
 
 
  
Characteristics: The larva is green, khaki, grey-brown or brown with dark spots. The topside is darker than the bottom side and a yellow or light brown stripe goes round the middle portion by the spots.
+
<h1>The experiment of PBAN</h1>
 +
[[File:PCRHAH5.png|left|thumb|900px|<p style="padding: 10px !important;">'''Fig.2-2''' The PCR result of the PBAN-HAH. The DNA sequence length of PBANs are around 100~150 bp, so the PCR products should appear at 300~350 bp.</p>]]
 +
<div style="display: block; height: 530pt;">
 +
After receiving the DNA sequences from the gene synthesis company, we recombined each PBAN gene to PSB1C3 backbones and conducted a PCR experiment to check the size of each of the PBANs. The DNA sequence length of the PBAN are around 100~150 bp. In this PCR experiment, the PBAN products size should be near at 415~515 bp. The '''Fig.2-2''' showed the correct size of the PBAN, and proved that we successful ligated the PBAN DNA sequence onto an ideal backbone.
 +
[[File:nctu006pcr.jpg|right|thumb|650px|'''Fig.2-3''' The plate of part-PBAN(''Helicoverpa armigera Hubner'')]]
 +
</div>
  
Damage: The cotton bollworm is a moth, the larvae of which feed on a wide range of plants, including many important cultivated crops. It is a major pest in cotton and one of the most polyphagous and cosmopolitan pest species. It should not be confused with the similarly named, related species Helicoverpa zea.The cotton bollworm is a highly polyphagous species.The most important crop hosts are tomato, cotton, pigeon pea, chickpea, sorghum and cowpea. Other hosts include groundnut, okra, peas, field beans, soybeans, lucerne, Phaseolus spp., other Leguminosae, tobacco, potatoes, maize, flax, Dianthus, Rosa, Pelargonium, Chrysanthemum, a number of fruit trees, forest trees and a range of vegetable crops.
+
<h1>'''Application of the part'''</h1>
 +
 
 +
[[File:HALFHAH5.png|thumb|link=|frameless|450px|center|'''Fig.3-1''' P<sub>cons</sub>+RBS+PBAN(''Helicoverpa armigera Hubner'')]]
 +
Moreover, to verify that all 9 kinds of PBAN can be expressed by the ''E.coli'', we conducted a SDS protein electrophoresis experiment. We first smashed the ''E.coli'' containing the PBAN with a sonicator and then took the supernatant divided from the bacterial pellet by centrifugation. Finally, we used the supernatant to run a SDS protein electrophoresis in a 20 % SDS gel.
 +
[[File:PRPBANHAH.jpg|thumb|center|700px|'''Fig.3-2''' Protein Electrophoresis of P<sub>cons</sub> + RBS + 5 different kinds of PBAN (control: plasmid of  P<sub>cons</sub>+RBS) Each peptide of PBAN is an around 30 amino acids, so we can see the band of PBANs at 2~4 kDa.<p>
 +
Below are biobrick serial numbers of PBAN abbrevation:</p>
 +
<p style="text-align:center;">BM: BBa_K1415001   AA: BBa_K1415009   LD: BBa_K1415104</p>
 +
<p style="text-align:center;">AS: BBa_K1415007   SL: BBa_K1415005</p>
 +
]]
 +
 
 +
<h2>Behavior of Target Insects After PBAN Treatment</h2>
 +
 
 +
To investigate what behavior the female moth would show after ingesting PBAN, we put one female moth into a beaker for observation. The beaker is divided into two parts by plastic wrap. The bottom part contains the PBAN solution we prepared, and the upper part is the space for the moth to stay. We soaked cotton that spans the entire length of the beaker with the PBAN solution and sprinkle it with sugar. This way, the moth can suck on the PBAN without drowning in PBAN solution. After all the equipment is set, we put the female moth into the upper part of the beaker. At the time, we started filming as soon as we observed the female moth showing obvious behaviors of sexual stimulation such as flapping their wings. In this observation, the sample moth is ''Helicoverpa armigera Hubner'' which we caught in Sunny Morning organic farm.
 +
We observed that the moth could absorb the PBAN in the solution through ingestion, and that the PBAN could stimulate the moth's pheromone gland to produce pheromone. As soon as the moth is sexually excited, it would flap its wings rapidly and move its tail slightly upward .
 +
<div style="font: italic bold 12px/30px Georgia, serif;">This video shows the behaviors of female moth after ingesting its separate PBANs. The moths clearly became excited and flapped their wings rapidly.
 +
</div>
 +
<div>
 +
<html>
 +
<div style="margin:0pxauto;">
 +
 <iframe width="620" height="348" src="//www.youtube.com/embed/nuxcWp1NPsY" frameborder="0" allowfullscreen></iframe>
 +
</div>
 +
</html>
 +
</div>
 +
 
 +
 
 +
<br><br><br><br>
 +
<h1></h1>
 +
 
 +
[[File:ALLHAH.png|780px|thumb||frameless|center|'''Fig.4-1''' Biobrick of P<sub>cons</sub> + RBS + PBAN(''Helicoverpa armigera Hubner'') + RBS + BFP + Ter.]]
 +
 
 +
To predict the PBAN expression in ''E.coli'' by computer modeling, we next tested PBAN BFP biobricks. We obtained the average expressive value of the blue fluorescence in the biobrick part (above) and also the control part of P<sub>cons</sub> + RBS + BFP + Ter. Therefore, we can use the average value to generate predictions of the PBAN expression in ''E.coli''. Below is the blue fluorescence expression curve and bacterial growth curve (OD 600) in a long period of time. We used these data to predict the PBAN expression in ''E.coli''.
 +
 
 +
[[File:Blue light flourescence of 9 different kinds of PBAN (2).png|center|650px|thumb|'''Fig.4-2'''  Blue Fluorescence of        P<sub>cons</sub> + RBS + PBAN(''Helicoverpa armigera Hubner'') + RBS + BFP + Ter.]]
 +
 
 +
 
 +
 
 +
 
 +
 
 +
[[File:nFLHAH.png|thumb|center|650px|'''Fig.4-3-1'''  The blue light fluorescence expression curve of E.coli containing Pcons + RBS + PBAN(HAH) + RBS + BFP + Ter plasmid (control: competent cells that cannot emit blue light).
 +
]]
 +
 
 +
 
 +
 
 +
 
 +
 
 +
 
 +
[[File:nODHAH2.png|thumb|center|650px|'''Fig.4-3-2''' The growth curves of PBAN(HAH)]]
 +
 
 +
 
 +
 
 +
 
 +
'''modeling'''
 +
[[File:MDHAH2.png|780px||thumb|frameless|center|'''Fig.4-5''' Modeling result of P<sub>cons</sub> + RBS + PBAN(''Helicoverpa armigera Hubner'') + BFP + Ter. The blue line is the expression profile of the theoretical biobrick. And the green line is the expression data of P<sub>cons</sub> + RBS + PBAN(''Helicoverpa armigera Hubner'') + BFP + Ter. And the red line is the adjusting line from the green and blue one. This line represent the correcting line of theoretical data and real condition data which can make our model not only fit the theoretical condition but also stay away from experimental bias.]]
 +
 
 +
 
 +
<h2>The device we design and working mechanism</h2>
 +
 
 +
[[file:How_we_are_going_to_use_PBAN.jpg|center|thumb|800px|'''Fig.4-6'''  Our Project Overview.]]
 +
 
 +
          <html>
 +
<iframe align="middle" width="75%" height="500" src="//www.youtube.com/embed/Q6htg6Qow3w" frameborder="0" allowfullscreen></iframe></div>
 +
</html>
 +
 
 +
In our project, we will biologically synthesize PBAN with our ''E.coli''. We store the PBAN inside a trapping device. In the device, there will be appropriate lighting and nutrient sources that will attract insects.
 +
 
 +
Once an insect is attracted into our device and ingests the nutrient sources we provide, it will also inevitably come in contact with our PBAN. As the PBAN works and activates the pheromone synthesis of the attracted insect, more of this species of insect’s counterparts will be attracted and later captured.
 +
 
 +
Owing to the first feature mentioned above, PBAN are species-specific, which means that it doesn't matter if other kind of insect fly into our device and eat PBAN, because the insects we don't want to catch will not be stimulated by PBANs to produce pheromone; our PBAN are only for what we want to catch, and we are sure that our method won't affect other kinds of insects.
 +
 
 +
 
 +
 
 +
<p></p>
 +
 
 +
 
 +
 
 +
 
 +
---------------------------------------------------------------------------------------------------------
  
Control: Cultural controls, with the exception of the use of Bt cotton and the use of mating disruption and sprays of the Entrust formulation of spinosad are acceptable to use on organically grown cotton.
 
  
[[File:PCRHAH4.png|right|600px|]]
 
[[File:pestHAH.png|leftt|300px|]]
 
 
<!-- Add more about the biology of this part here
 
<!-- Add more about the biology of this part here
 
===Usage and Biology===
 
===Usage and Biology===
  
 
<!-- -->
 
<!-- -->
<span class='h3bb'>Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL</span>
+
 
 
<partinfo>BBa_K1415006 SequenceAndFeatures</partinfo>
 
<partinfo>BBa_K1415006 SequenceAndFeatures</partinfo>
  
  
<!-- Uncomment this to enable Functional Parameter display
+
 
===Functional Parameters===
+
 
 +
==Functional Parameters: Austin_UTexas==
 +
<html>
 +
<body>
 
<partinfo>BBa_K1415006 parameters</partinfo>
 
<partinfo>BBa_K1415006 parameters</partinfo>
<!-- -->
+
<h3><center>Burden Imposed by this Part:</center></h3>
 +
<figure>
 +
<div class = "center">
 +
<center><img src = "https://static.igem.org/mediawiki/parts/f/fa/T--Austin_Utexas--no_burden_icon.png" style = "width:160px;height:120px"></center>
 +
</div>
 +
<figcaption><center><b>Burden Value: 0.9 ± 1.0% </b></center></figcaption>
 +
</figure>
 +
<p> Burden is the percent reduction in the growth rate of <i>E. coli</i> cells transformed with a plasmid containing this BioBrick (± values are 95% confidence limits). This BioBrick did not exhibit a burden that was significantly greater than zero (i.e., it appears to have little to no impact on growth). Therefore, users can depend on this part to remain stable for many bacterial cell divisions and in large culture volumes. Refer to any one of the
 +
<a href="https://parts.igem.org/Part:BBa_K3174002">BBa_K3174002</a> - <a href="https://parts.igem.org/Part:BBa_K3174007">BBa_K3174007</a> pages for more information on the methods, an explanation of the sources of burden,  and other conclusions from a large-scale measurement project conducted by the <a href="http://2019.igem.org/Team:Austin_UTexas">2019 Austin_UTexas team</a>.</p>
 +
<p>This functional parameter was added by the <a href="https://2020.igem.org/Team:Austin_UTexas/Contribution">2020 Austin_UTexas team.</a></p>
 +
</body>
 +
</html>

Latest revision as of 18:59, 27 August 2020

PBAN (Helicoverpa armigera Hubner)

Introduction: PBAN (Pheromone Biosynthesis Activating Neuropeptide)

Fig.1-1 A coding gene of a Helicoverpa armigera Hubner's PBAN

Mechanism of PBAN

PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.

Features of PBAN

1. Species-specific: PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with its specific receptor, resulting in the production of a particular pheromone.

2. Small and simple: The coding sequence for a PBAN is only around 100 base pairs. For E.coli, 100 base pairs is totally within its working capacity. Therefore, E.coli can be a low-cost PBAN factory. By transforming the DNA sequences for different PBAN into the E.coli, we can even gain a variety of PBANs.  

3. Secreted directly: Because PBAN is secreted by the insect itself, the insect would not form a resistance to it compare to use pesticide.

Together, using PBAN is totally a environmental friendly way for solving harmful insects problems with easily triggering pheromone production by contacting with its receptor.

This part is a coding gene of Helicoverpa armigera Hubner's PBAN.


See our expanding PBAN (Helicoverpa armigera Hubner) parts collection: Pcons+B0034+PBAN(Helicoverpa armigera Hubner) and Pcons+B0034+PBAN(Helicoverpa armigera Hubner)+B0034+BFP+J61048

Fig.1-2 Working mechanism of PBAN
Reference:

Ada Rafaeli, Pheromone biosynthesis activating neuropeptide (PBAN): Regulatory role and mode of action, General and Comparative Endocrinology 162 (2009) 69–78.




Target insect: Cotton bollworm (Helicoverpa armigera Hubner)

Fig.2-1 Introduction of Helicoverpa armigera Hubner


The experiment of PBAN

Fig.2-2 The PCR result of the PBAN-HAH. The DNA sequence length of PBANs are around 100~150 bp, so the PCR products should appear at 300~350 bp.

After receiving the DNA sequences from the gene synthesis company, we recombined each PBAN gene to PSB1C3 backbones and conducted a PCR experiment to check the size of each of the PBANs. The DNA sequence length of the PBAN are around 100~150 bp. In this PCR experiment, the PBAN products size should be near at 415~515 bp. The Fig.2-2 showed the correct size of the PBAN, and proved that we successful ligated the PBAN DNA sequence onto an ideal backbone.

Fig.2-3 The plate of part-PBAN(Helicoverpa armigera Hubner)

Application of the part

Fig.3-1 Pcons+RBS+PBAN(Helicoverpa armigera Hubner)

Moreover, to verify that all 9 kinds of PBAN can be expressed by the E.coli, we conducted a SDS protein electrophoresis experiment. We first smashed the E.coli containing the PBAN with a sonicator and then took the supernatant divided from the bacterial pellet by centrifugation. Finally, we used the supernatant to run a SDS protein electrophoresis in a 20 % SDS gel.

Fig.3-2 Protein Electrophoresis of Pcons + RBS + 5 different kinds of PBAN (control: plasmid of Pcons+RBS) Each peptide of PBAN is an around 30 amino acids, so we can see the band of PBANs at 2~4 kDa.

Below are biobrick serial numbers of PBAN abbrevation:

BM: BBa_K1415001   AA: BBa_K1415009   LD: BBa_K1415104

AS: BBa_K1415007   SL: BBa_K1415005

Behavior of Target Insects After PBAN Treatment

To investigate what behavior the female moth would show after ingesting PBAN, we put one female moth into a beaker for observation. The beaker is divided into two parts by plastic wrap. The bottom part contains the PBAN solution we prepared, and the upper part is the space for the moth to stay. We soaked cotton that spans the entire length of the beaker with the PBAN solution and sprinkle it with sugar. This way, the moth can suck on the PBAN without drowning in PBAN solution. After all the equipment is set, we put the female moth into the upper part of the beaker. At the time, we started filming as soon as we observed the female moth showing obvious behaviors of sexual stimulation such as flapping their wings. In this observation, the sample moth is Helicoverpa armigera Hubner which we caught in Sunny Morning organic farm. We observed that the moth could absorb the PBAN in the solution through ingestion, and that the PBAN could stimulate the moth's pheromone gland to produce pheromone. As soon as the moth is sexually excited, it would flap its wings rapidly and move its tail slightly upward .

This video shows the behaviors of female moth after ingesting its separate PBANs. The moths clearly became excited and flapped their wings rapidly.

 






Fig.4-1 Biobrick of Pcons + RBS + PBAN(Helicoverpa armigera Hubner) + RBS + BFP + Ter.

To predict the PBAN expression in E.coli by computer modeling, we next tested PBAN BFP biobricks. We obtained the average expressive value of the blue fluorescence in the biobrick part (above) and also the control part of Pcons + RBS + BFP + Ter. Therefore, we can use the average value to generate predictions of the PBAN expression in E.coli. Below is the blue fluorescence expression curve and bacterial growth curve (OD 600) in a long period of time. We used these data to predict the PBAN expression in E.coli.

Fig.4-2 Blue Fluorescence of Pcons + RBS + PBAN(Helicoverpa armigera Hubner) + RBS + BFP + Ter.



Fig.4-3-1 The blue light fluorescence expression curve of E.coli containing Pcons + RBS + PBAN(HAH) + RBS + BFP + Ter plasmid (control: competent cells that cannot emit blue light).




Fig.4-3-2 The growth curves of PBAN(HAH)



modeling

Fig.4-5 Modeling result of Pcons + RBS + PBAN(Helicoverpa armigera Hubner) + BFP + Ter. The blue line is the expression profile of the theoretical biobrick. And the green line is the expression data of Pcons + RBS + PBAN(Helicoverpa armigera Hubner) + BFP + Ter. And the red line is the adjusting line from the green and blue one. This line represent the correcting line of theoretical data and real condition data which can make our model not only fit the theoretical condition but also stay away from experimental bias.


The device we design and working mechanism

Fig.4-6 Our Project Overview.

          

In our project, we will biologically synthesize PBAN with our E.coli. We store the PBAN inside a trapping device. In the device, there will be appropriate lighting and nutrient sources that will attract insects.

Once an insect is attracted into our device and ingests the nutrient sources we provide, it will also inevitably come in contact with our PBAN. As the PBAN works and activates the pheromone synthesis of the attracted insect, more of this species of insect’s counterparts will be attracted and later captured.

Owing to the first feature mentioned above, PBAN are species-specific, which means that it doesn't matter if other kind of insect fly into our device and eat PBAN, because the insects we don't want to catch will not be stimulated by PBANs to produce pheromone; our PBAN are only for what we want to catch, and we are sure that our method won't affect other kinds of insects.







Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    INCOMPATIBLE WITH RFC[25]
    Illegal NgoMIV site found at 18
  • 1000
    COMPATIBLE WITH RFC[1000]



Functional Parameters: Austin_UTexas

BBa_K1415006 parameters

Burden Imposed by this Part:

Burden Value: 0.9 ± 1.0%

Burden is the percent reduction in the growth rate of E. coli cells transformed with a plasmid containing this BioBrick (± values are 95% confidence limits). This BioBrick did not exhibit a burden that was significantly greater than zero (i.e., it appears to have little to no impact on growth). Therefore, users can depend on this part to remain stable for many bacterial cell divisions and in large culture volumes. Refer to any one of the BBa_K3174002 - BBa_K3174007 pages for more information on the methods, an explanation of the sources of burden, and other conclusions from a large-scale measurement project conducted by the 2019 Austin_UTexas team.

This functional parameter was added by the 2020 Austin_UTexas team.