Difference between revisions of "Part:BBa K1362400"
(→‎Nostoc punctiforme DnaE split intein (NpuDnaE))
Line 4: Line 4:
 
<i>Npu</i>DnaE split Intein, N-terminal half. This is a DNA piece for cloning used to assemble other BioBrick parts.
 
<i>Npu</i>DnaE split Intein, N-terminal half. This is a DNA piece for cloning used to assemble other BioBrick parts.
  
−
===<i>Nostoc punctiforme</i> DnaE split intein (<i>Npu</i>DnaE)===
+
===<i>Nostoc punctiforme</i> DnaE split intein (<i>Npu</i> DnaE)===
 
Inteins can be found in all kingdoms of life, however their use for the organism remains yet unknown. In the past years many intein sequences were found in the genomes of cyanobacteria.
 
Inteins can be found in all kingdoms of life, however their use for the organism remains yet unknown. In the past years many intein sequences were found in the genomes of cyanobacteria.
−
<i>Npu</i>DnaE is a naturally split intein from the alpha subunit of Dna Polymerase III in Nostoc punctiforme bacteria which shows [[{{PAGENAME}}:Design#References|[1]]] extraordinarly high splicing activity and therefore is currently still on of the gold-standards for inteins.
+
<i>Npu</i> DnaE is a naturally split intein from the alpha subunit of Dna Polymerase III in Nostoc punctiforme bacteria which shows [[{{PAGENAME}}:Design#References|[1]]] extraordinarly high splicing activity and therefore is currently still on of the gold-standards for inteins.
  
 
<pre>
 
<pre>
Line 15: Line 15:
 
</pre>
 
</pre>
  
−
The sequences above are specified with three native extein residues on each of the termini. Please note that in the case of <i>>Npu</i> DnaE these are not the most efficient amino acids in supporting the splicing reaction. Detailed information that we found to be very useful is given in [[{{PAGENAME}}:Design#References|[2]]].
+
The sequences above are specified with three native extein residues on each of the termini. Please note that in the case of <i>Npu</i> DnaE these are not the most efficient amino acids in supporting the splicing reaction. Detailed information that we found to be very useful is given in [[{{PAGENAME}}:Design#References|[2]]].
  
 
<!-- Add more about the biology of this part here
 
<!-- Add more about the biology of this part here

Revision as of 10:54, 19 October 2014

NpuDnaE N-Intein cloning piece

NpuDnaE split Intein, N-terminal half. This is a DNA piece for cloning used to assemble other BioBrick parts.

Nostoc punctiforme DnaE split intein (Npu DnaE)

Inteins can be found in all kingdoms of life, however their use for the organism remains yet unknown. In the past years many intein sequences were found in the genomes of cyanobacteria. Npu DnaE is a naturally split intein from the alpha subunit of Dna Polymerase III in Nostoc punctiforme bacteria which shows [1] extraordinarly high splicing activity and therefore is currently still on of the gold-standards for inteins. 

Amino Acid Sequence:

N-Intein: AEY | CLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRVDNLPN
C-Intein: MIKIATRKYLGKQNVYDIGVERDHNFALKNGFIASN | CFN

The sequences above are specified with three native extein residues on each of the termini. Please note that in the case of Npu DnaE these are not the most efficient amino acids in supporting the splicing reaction. Detailed information that we found to be very useful is given in [2].

Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    COMPATIBLE WITH RFC[25]
  • 1000
    COMPATIBLE WITH RFC[1000]