Hyd-S11-1
Protein sequence:
MIRQLIEVDRVRTIAVAGYSLGGNLTLKLAGELADAAPPELKAVCAVSPTMDLAVCVEALERKSNILYEWNFVRNLKARMRLKSALWPGTFDLAGLRHVKTVRQFDDAYTAPHHGFRDAADYYHRASAMRIIDRIRIPALIVTAEDDPFVPAEPFRDPLVTNNPNLTVVVTPTGGHCAFVERAEPDYDGYWAEREIVRFATAHLAGPRAPQHPAKLMAL
Plasmid Profile:
Plasmid Profile
PCR Gel Charts:
M: Marker, 2000 bp; Line20: Hyd-S11-1(564 bp)
Results of Western Blot:
M: Maker; C: CK; Line6: Hyd-S11-1,24.36kDa
Loss of Weight (rate of degradation of original membrane weight, etc.): 0.423%
Line1: CK; Line6: Hdy-S11-1;
Scanning Electron Microscope Image:
Scanning Electron Microscope Image
Fourier Diagram:
Plastic Film(Carbonyl index(CI):2.22%)
Plastic Microspheres(Carbonyl index(CI):3.50%):
Plastic Microspheres(Carbonyl index(CI):3.50%)