Difference between revisions of "Part:BBa K3889029"

 
 
Line 3: Line 3:
 
<partinfo>BBa_K3889029 short</partinfo>
 
<partinfo>BBa_K3889029 short</partinfo>
  
−
This is the region of Zona pellucida glycoprotein 2 after its cleavage at the consensus furin cleavage site.
 
  
−
<!-- Add more about the biology of this part here
+
Partial part of ZP2 that is cleaved by ovastacin (<partinfo>BBa_K3889024</partinfo>).
 +
 
 
===Usage and Biology===
 
===Usage and Biology===
 +
The human Zona Pellucida (ZP) matrix, a network of thin interconnected filaments, is primarily composed of four glycoproteins, namely, ZP1, ZP2, ZP3, and ZP4. All four zona proteins share common structural elements including a signal peptide, ZP domain, consensus furin cleavage site (CFCS), transmembrane-like domain, and cytoplasmic tail [1]. The mature protein lacks the transmembrane-like domain after getting cleaved at the CFCS site, It then gets transported to form bonds with other glycoprotein components and form the extracellular matrix [1].
 +
 +
The cleavage of mature ZP2 (120 kDa) by ovastacin yields two fragments (90 kDa + 30 kDa) [3] at a conserved cleavage site (167LA↓DE170) [4]. The two protein fragments remain covalently attached via the disulfide bond of ZP2 and mechanistically induce ZP hardening [2].
 +
[[File:T--IISER-Tirupati_India--Docking_Alt_(2).png|centre]]<br>
 +
Fig 1. Zona Pellucida 2 chain marked with beige (Cleavage site marked with green) docked with Phosphomimetic variant of ovastacin marked with sky blue (active site marked with magenta and specified with histidine residues marked with dark blue)
 +
===Native protein sequence of ZP2===
 +
 +
IDVSQLVNPAFPGTVTCDEREITVEFPSSPGTKKWHASVVDPLGLDMPNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPAMQVEET QGLSASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLPEAMKEGFSLLIDNHRMTFHVPFNATGVTHYVQGNSHLYMVSLKLTFISPGQKVIF SSQAICAPDPVTCNATHMTLTIPEFPGKLKSVSFENQNIDVSQLHDNGIDLEATNGMKLHFSKTLLKTKLSEKCLLHQFYLASLKLTFLLRPETVSMVIYPECLCESPV SIVTGELCTQDGFMDVEVYSYQTQPALDLGTLRVGNSSCQPVFEAQSQGLVRFHIPLNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDML LNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPYGENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDDCWATSTMDPDSFPQWNVVVDGCAYDLDNYQTTFHPVGS SVTHPDHYQRFDMKAFAFVSEAHVLSSLVYFHCSALICNRLSPDSPLCSVTCPVSS
  
−
<!-- -->
 
 
<span class='h3bb'>Sequence and Features</span>
 
<span class='h3bb'>Sequence and Features</span>
 
<partinfo>BBa_K3889029 SequenceAndFeatures</partinfo>
 
<partinfo>BBa_K3889029 SequenceAndFeatures</partinfo>
Line 17: Line 24:
 
<partinfo>BBa_K3889029 parameters</partinfo>
 
<partinfo>BBa_K3889029 parameters</partinfo>
 
<!-- -->
 
<!-- -->
 +
 +
===References===
 +
1. Gupta, S. K. (2018). The Human Egg’s Zona Pellucida. In Current Topics in Developmental Biology (pp. 379–411). Elsevier. https://doi.org/10.1016/bs.ctdb.2018.01.001
 +
 +
 +
2. Fahrenkamp, E., Algarra, B., & Jovine, L. (2020). Mammalian egg coat modifications and the block to polyspermy. In Molecular Reproduction and Development (Vol. 87, Issue 3, pp. 326–340). Wiley. https://doi.org/10.1002/mrd.23320
 +
 +
3. Bleil, J. D., Beall, C. F., & Wassarman, P. M. (1981). Mammalian sperm-egg interaction: fertilization of mouse eggs triggers modification of the major zona pellucida glycoprotein, ZP2. Developmental biology, 86(1), 189–197. https://doi.org/10.1016/0012-1606(81)90329-8
 +
 +
4. Gahlay, G., Gauthier, L., Baibakov, B., Epifano, O., & Dean, J. (2010). Gamete recognition in mice depends on the cleavage status of an egg's zona pellucida protein. Science (New York, N.Y.), 329(5988), 216–219. https://doi.org/10.1126/science.1188178

Latest revision as of 07:24, 18 October 2021


Homo sapiens zona pellucida glycoprotein 2_cDNA


Partial part of ZP2 that is cleaved by ovastacin (BBa_K3889024).

Usage and Biology

The human Zona Pellucida (ZP) matrix, a network of thin interconnected filaments, is primarily composed of four glycoproteins, namely, ZP1, ZP2, ZP3, and ZP4. All four zona proteins share common structural elements including a signal peptide, ZP domain, consensus furin cleavage site (CFCS), transmembrane-like domain, and cytoplasmic tail [1]. The mature protein lacks the transmembrane-like domain after getting cleaved at the CFCS site, It then gets transported to form bonds with other glycoprotein components and form the extracellular matrix [1].

The cleavage of mature ZP2 (120 kDa) by ovastacin yields two fragments (90 kDa + 30 kDa) [3] at a conserved cleavage site (167LA↓DE170) [4]. The two protein fragments remain covalently attached via the disulfide bond of ZP2 and mechanistically induce ZP hardening [2].

T--IISER-Tirupati India--Docking Alt (2).png

Fig 1. Zona Pellucida 2 chain marked with beige (Cleavage site marked with green) docked with Phosphomimetic variant of ovastacin marked with sky blue (active site marked with magenta and specified with histidine residues marked with dark blue)

Native protein sequence of ZP2

IDVSQLVNPAFPGTVTCDEREITVEFPSSPGTKKWHASVVDPLGLDMPNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPAMQVEET QGLSASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLPEAMKEGFSLLIDNHRMTFHVPFNATGVTHYVQGNSHLYMVSLKLTFISPGQKVIF SSQAICAPDPVTCNATHMTLTIPEFPGKLKSVSFENQNIDVSQLHDNGIDLEATNGMKLHFSKTLLKTKLSEKCLLHQFYLASLKLTFLLRPETVSMVIYPECLCESPV SIVTGELCTQDGFMDVEVYSYQTQPALDLGTLRVGNSSCQPVFEAQSQGLVRFHIPLNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDML LNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPYGENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDDCWATSTMDPDSFPQWNVVVDGCAYDLDNYQTTFHPVGS SVTHPDHYQRFDMKAFAFVSEAHVLSSLVYFHCSALICNRLSPDSPLCSVTCPVSS

Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    COMPATIBLE WITH RFC[25]
  • 1000
    COMPATIBLE WITH RFC[1000]


References

1. Gupta, S. K. (2018). The Human Egg’s Zona Pellucida. In Current Topics in Developmental Biology (pp. 379–411). Elsevier. https://doi.org/10.1016/bs.ctdb.2018.01.001


2. Fahrenkamp, E., Algarra, B., & Jovine, L. (2020). Mammalian egg coat modifications and the block to polyspermy. In Molecular Reproduction and Development (Vol. 87, Issue 3, pp. 326–340). Wiley. https://doi.org/10.1002/mrd.23320

3. Bleil, J. D., Beall, C. F., & Wassarman, P. M. (1981). Mammalian sperm-egg interaction: fertilization of mouse eggs triggers modification of the major zona pellucida glycoprotein, ZP2. Developmental biology, 86(1), 189–197. https://doi.org/10.1016/0012-1606(81)90329-8

4. Gahlay, G., Gauthier, L., Baibakov, B., Epifano, O., & Dean, J. (2010). Gamete recognition in mice depends on the cleavage status of an egg's zona pellucida protein. Science (New York, N.Y.), 329(5988), 216–219. https://doi.org/10.1126/science.1188178