Difference between revisions of "Part:BBa K3264000"
| Line 5: | Line 5: | ||
NT-2Rep-CT is the recombinant spider silk protein (spidroin) that can spin into artificial spider silk fiber. This part is one of our parts in the part collection that provides recombinant chromoprotein and spidroins. The part collection enables us to artificially spin spider silks of different colors or fluorescence. | NT-2Rep-CT is the recombinant spider silk protein (spidroin) that can spin into artificial spider silk fiber. This part is one of our parts in the part collection that provides recombinant chromoprotein and spidroins. The part collection enables us to artificially spin spider silks of different colors or fluorescence. | ||
| − | + | ==Usage and Biology== | |
Spider silk serves as a new material with superior properties that can be applied in medication, cloth, and aerospace fields. However, spider breeding is not applicable due to spider's fierce behavior. The current approach is to produce recombinant spidroins (silk proteins) from other chassis and spin them into silk. | Spider silk serves as a new material with superior properties that can be applied in medication, cloth, and aerospace fields. However, spider breeding is not applicable due to spider's fierce behavior. The current approach is to produce recombinant spidroins (silk proteins) from other chassis and spin them into silk. | ||
| Line 13: | Line 13: | ||
Based on the part NT-2Rep-CT, development was carried out by our group to enable a step closer the recently unattainable size of nature spidroin(556 kDa) that contains192 repeat motifs of the ''Nephila clavipes'' dragline spidroin. More details please go to NT4RepCT. | Based on the part NT-2Rep-CT, development was carried out by our group to enable a step closer the recently unattainable size of nature spidroin(556 kDa) that contains192 repeat motifs of the ''Nephila clavipes'' dragline spidroin. More details please go to NT4RepCT. | ||
| − | + | ==Design Considerations== | |
We coded the nucleotide sequence of NT-2Rep-CT. | We coded the nucleotide sequence of NT-2Rep-CT. | ||
The construction is includes: | The construction is includes: | ||
| Line 28: | Line 28: | ||
Also, the linker between the NT/CT and the 2Rep(repetitive region) is GNS | Also, the linker between the NT/CT and the 2Rep(repetitive region) is GNS | ||
The construct was cloned into a pT7 plasmid and transformed into BL21 (DE3) ''E. coli''. | The construct was cloned into a pT7 plasmid and transformed into BL21 (DE3) ''E. coli''. | ||
| + | |||
| + | == Characterization== | ||
| + | We aimed to use a synthetic biology approach to combine standardized DNA part NT-2Rep-CT, and transform constructs to metabolically engineered ''E. coli'' for bioproduction. | ||
| + | ===Purification and SDS PAGE=== | ||
<span class='h3bb'>Sequence and Features</span> | <span class='h3bb'>Sequence and Features</span> | ||
Revision as of 15:18, 20 October 2019
NT-2Rep-CT
NT-2Rep-CT is the recombinant spider silk protein (spidroin) that can spin into artificial spider silk fiber. This part is one of our parts in the part collection that provides recombinant chromoprotein and spidroins. The part collection enables us to artificially spin spider silks of different colors or fluorescence.
Usage and Biology
Spider silk serves as a new material with superior properties that can be applied in medication, cloth, and aerospace fields. However, spider breeding is not applicable due to spider's fierce behavior. The current approach is to produce recombinant spidroins (silk proteins) from other chassis and spin them into silk.
NT-2Rep-CT is the common architecture in two main types of spider silk proteins: major ambulate spidroins(MaSps) and minor ampullate spidorins (MiSps). (Andersson, Marlene, et al. 2017) NT is a non-repetitive N-terminal domain, as well as CT, the C-terminal domain. In between them is an extensive repetitive region. (Andersson, Marlene, et al. 2017) In the storage of spider silk protein, NT is a monomeric and highly soluble region in neutral pH, and it provides the solubility of the entire spidorin. NT can form stable dimers when pH decreases in the spinning duct. On the other side during the decrease of pH, the CT gets disrupted and unfold to turn in the beta-sheet amyloid-like fibrils. It is hypothesized that structural change of CT precipitate the change of the repetitive region to beta-sheet conformation. (Andersson, Marlene, et al. 2017) Based on the part NT-2Rep-CT, development was carried out by our group to enable a step closer the recently unattainable size of nature spidroin(556 kDa) that contains192 repeat motifs of the Nephila clavipes dragline spidroin. More details please go to NT4RepCT.
Design Considerations
We coded the nucleotide sequence of NT-2Rep-CT. The construction is includes:
1. a 6× His tag (MGHHHHHHM) that enables us to carry out Ni-NTA protein purification
2. an N-terminal domain based on the E. australis MaSp1 sequence (Andersson, Marlene, et al. 2017) (SHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDM STIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGG SLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA)
3. a repetitive part consisting of two polyalanine and glycine-rich repeat regions from MaSp1 of E. australis (Andersson, Marlene, et al. 2017) (GNSGRGQGGYGQGSGGNAAAAAAAAAAAAAAAGQGGQGGYGR QSQGAGSAAAAAAAAAAAAAAGSGQGGYGGQGQGGYGQSGNS)
4. a C-terminal domain based on the A. ventricosus MiSp sequence (Andersson, Marlene, et al. 2017) (VTSGGYGYGTSAAAGAGVAAGSYAGAVN RLSSAEAASRVSSNIAAIASGGASALPSVISNIYSGVVA SGVSSNEALI QALL ELLSALVHVLSSASIGNVSSVGVDSTLNVVQ DSVGQYVG;). Also, the linker between the NT/CT and the 2Rep(repetitive region) is GNS The construct was cloned into a pT7 plasmid and transformed into BL21 (DE3) E. coli.
Characterization
We aimed to use a synthetic biology approach to combine standardized DNA part NT-2Rep-CT, and transform constructs to metabolically engineered E. coli for bioproduction.
Purification and SDS PAGE
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25COMPATIBLE WITH RFC[25]
- 1000COMPATIBLE WITH RFC[1000]