Difference between revisions of "Part:BBa K3038000"
(→Description) |
(→Description) |
||
Line 25: | Line 25: | ||
Secondary alcohol + NAD+ = ketone + H+ + NADH | Secondary alcohol + NAD+ = ketone + H+ + NADH | ||
EC:1.1.1.1 | EC:1.1.1.1 | ||
+ | |||
+ | ==Usage and Biology== | ||
+ | The alcohol deshydrogenase catalyzes the oxidation reaction of many alcohols. In our case, it allows to oxidize fatty acids. ADH bacteria have a reverse function to that describe in the human body. It then produces alcohol by generating NAD+. This is called alcoholic fermentation. | ||
+ | |||
+ | ==Design== | ||
+ | Thanks to Geneious software we have designed a gene with a promoter, a C-Myc and 6-His tag and a terminator. The promoter is inducible to arabinose. This allows a controlled expression of the synthetic gene to avoid any effect of toxicity. In addition, arabinose is an inexpensive inducer and very present in the laboratories of our university. The allows to purify and detect the protein in the host strain by using Ni-NTA columns or specific antibodies. | ||
+ | |||
+ | ==Manipulations== | ||
+ | |||
+ | |||
+ | ===PCR amplification=== | ||
+ | |||
+ | |||
+ | https://2019.igem.org/wiki/images/4/40/T--Poitiers--PCR_amplification_ADR-tab3.jpg | ||
+ | |||
+ | Electrophoresis photography following deposits on agarose gel 0.8% of enzymatic digestion products. The migration was performed at 100 volts for 30 minutes in TAE 1X. The marker used during the migration is the NEB 1 kb Plus Ladder. Lane 1 corresponds to the marker, lane 2 to the digested N-ter,ADR lane 3 to the digested C-ter ADR and lane 4 to the digested plasmid pSB1A3. | ||
+ | |||
+ | |||
+ | ===Cloning design in pSB1A3=== | ||
+ | |||
+ | https://2019.igem.org/wiki/images/5/5b/T--Poitiers--plasmid_construction_ADR-tab3.jpg | ||
+ | |||
+ | Design of ADR N-ter/pSB1A3 and ADR C-ter/pSB1A3 with Geneious software. This map shows the pBAD promoter and its terminator flanking the coding sequence of the ADR protein. Also present in N-ter or C-ter are 6-His and c-myc tag. Finally, in the plasmid is present and ampicillin resistance cassette. | ||
+ | |||
+ | |||
+ | ===Expression of the CMYC-6HIS-ADR and ADR-CMYC-6HIS recombinant proteins=== | ||
+ | |||
+ | https://2019.igem.org/wiki/images/6/67/T--Poitiers--recombinantexpression_ADR-tab3.png | ||
+ | |||
+ | NI : Not induced | ||
+ | I: Induced | ||
+ | |||
+ | After sequencing, induction was performed on the thermocompetent bacteria JM109. The objective was to verify if the cloned gene leads to the production of a protein. The expected size of the ADR protein is 40 kDa. A very strong expression of the ADR protein was observed at this size when the pBAD promoter is induced with arabinose. The gene has therefore been correctly cloned into the strain and the protein is produced. | ||
+ | |||
+ | ===Activity=== | ||
+ | |||
+ | <!-- --> | ||
+ | <span class='h3bb'>Sequence and Features</span> | ||
+ | <partinfo>BBa_K3038000 SequenceAndFeatures</partinfo> | ||
+ | |||
+ | |||
+ | <!-- Uncomment this to enable Functional Parameter display | ||
+ | ===Functional Parameters=== | ||
+ | <partinfo>BBa_K3038000 parameters</partinfo> | ||
+ | <!-- --> | ||
+ | </div> |
Revision as of 12:05, 18 October 2019
Contents
Description
Alcohol dehydrogenase, ADH or ADR N-term, is a BioBrick C-Myc and 6-His tagged in N-term.
ADR is a thermophilic NAD+ dependent alcohol dehydrogenase. This enzyme bears mainly an ethanol-dehydrogenase activity.
GenBank
ADR : GenBank: P42327
https://www.ncbi.nlm.nih.gov/protein/P42327
Protein Sequence
MEQKLISEEDLNSAVDHHHHHHVKAAVVNEFKKALEIKEVERPKLEEGEVLVKIEACGVCHTDLHAAHGD WPIKPKLPLIPGHEGVGIVVEVAKGVKSIKVGDRVGIPWLYSACGECEYCLTGQETLCPHQLNGGYSVDG GYAEYCKAPADYVAKIPDNLDPVEVAPILCAGVTTYKALKVSGARPGEWVAIYGIGGLGHIALQYAKAMG LNVVAVDISDEKSKLAKDLGADIAINGLKEDPVKAIHDQVGGVHAAISVAVNKKAFEQAYQSVKRGGTLV VVGLPNADLPIPIFDTVLNGVSVKGSIVGTRKDMQEALDFAARGKVRPIVETAELEEINEVFERMEKGKI NGRIVLKLKED
Reaction
Primary alcohol + NAD+ = Aldehyde + NADH + H+ Secondary alcohol + NAD+ = ketone + H+ + NADH EC:1.1.1.1
Usage and Biology
The alcohol deshydrogenase catalyzes the oxidation reaction of many alcohols. In our case, it allows to oxidize fatty acids. ADH bacteria have a reverse function to that describe in the human body. It then produces alcohol by generating NAD+. This is called alcoholic fermentation.
Design
Thanks to Geneious software we have designed a gene with a promoter, a C-Myc and 6-His tag and a terminator. The promoter is inducible to arabinose. This allows a controlled expression of the synthetic gene to avoid any effect of toxicity. In addition, arabinose is an inexpensive inducer and very present in the laboratories of our university. The allows to purify and detect the protein in the host strain by using Ni-NTA columns or specific antibodies.
Manipulations
PCR amplification
Electrophoresis photography following deposits on agarose gel 0.8% of enzymatic digestion products. The migration was performed at 100 volts for 30 minutes in TAE 1X. The marker used during the migration is the NEB 1 kb Plus Ladder. Lane 1 corresponds to the marker, lane 2 to the digested N-ter,ADR lane 3 to the digested C-ter ADR and lane 4 to the digested plasmid pSB1A3.
Cloning design in pSB1A3
Design of ADR N-ter/pSB1A3 and ADR C-ter/pSB1A3 with Geneious software. This map shows the pBAD promoter and its terminator flanking the coding sequence of the ADR protein. Also present in N-ter or C-ter are 6-His and c-myc tag. Finally, in the plasmid is present and ampicillin resistance cassette.
Expression of the CMYC-6HIS-ADR and ADR-CMYC-6HIS recombinant proteins
NI : Not induced I: Induced
After sequencing, induction was performed on the thermocompetent bacteria JM109. The objective was to verify if the cloned gene leads to the production of a protein. The expected size of the ADR protein is 40 kDa. A very strong expression of the ADR protein was observed at this size when the pBAD promoter is induced with arabinose. The gene has therefore been correctly cloned into the strain and the protein is produced.
Activity
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25COMPATIBLE WITH RFC[25]
- 1000COMPATIBLE WITH RFC[1000]