Difference between revisions of "Part:BBa K1998014"

Revision as of 02:55, 21 October 2016

psbDCA

Sequence and Features

Overview

This part is composed of psbD, psbC and psbA. These parts make up one of the operons in the photosystem II pathway. The psbD gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core. The psbC gene that comprises this part codes a subunit that makes up the Photosystem II protein P680. The P680 complex is photosystem II primary electron donor. The psbA gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core.
Together, these genes make up one of the operons in our PSII pathway.

Biology & Literature

The psbD<i/> gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core P680 [1, 2]. It has been shown that the <i>psbD gene is highly conserved within C. rienhardtii [3]. Mutations in the psbD gene causes the D2 peptide to not be visible when screened perhaps indicating it's instability within the complex [3]. In addition it was found that other proteins are affected by a mutation in the psbD gene due to the lack of accumulation of other PSII proteins. Therefore the role of psbD is to provide stability in the membrane of the complex as well as to regulate the expression of the D1 protein of the complex [3].

The psbC gene encodes CP43 protein which connects with the CP47 encoded by psbB. Along with the CP47, psbC form a proximal antennae. This conducts electron excitation from the external antennae to the PSII core reaction centre [4]. Due to results from deletion studies, the role of the CP43/psbC protein has been described as non-essential for the PSII core assembly [4]. Other studies have found it however helps with the accumulation of the PSII complexes and light harvesting efficiency [5].

The psbA gene encodes the D1 subunit of PSII. Along with the psbD which encodes the D2 subunit, it forms a heterodimer. This forms the PSII reaction centre [6] which is responsible for electron transfer from chlorophyll P680 to quinones QA and QB. It is also vital to the assembly of the oxygen evolving complex and QB within PSII [7].

Part Verification

Fig 1. Gel electrophoresis of the Photosystem II parts, here psbDCA is shown to be the correct size of 3501bp with a cam backbone of 2,070bp, when compaired to 1kb on the gel, which validates the Biobrick parts and backbones.

Protein information

psbD
Mass: 43kDa
Sequence:
LEGFTLYASGSYVVWKEVKKQLRSVHIKRNAHGSMTLMTGFVKTVSYSVGQVYYYSLVLTLHVVGLVLLSLLHGIRMVLLLTKVVTSQQLFLHLLTVWLTLFYLFGVQKLKVI SLVGVNLVVYGHSLLYTVHLVLVSCFVSLKLLVQTYVHTTQLLSQHQLLYSFQYSFTHVNQVGSLHLVSVLLSSVSFYSSKVSTTGHLTHSTWVLLVFVLLYYVLFTVLLLKTH YSKTVTVLTHSVHSTLHRLKKHTLWLLLTVSGHKSSVLLSLTNVGFTSSCYFQLVFGVLLVLVLTYVLTTSYHKRFVLLKNPEFETFYTKKHSSRKVFLAWKGCFRTNHTKRL VFSKKIYHRGKPSYITNKRRLAIPGKKRARGSHPRALFFQKX

psbC
Mass: 50.64kDa
Sequence:
METLFNGTLTVGGRDQETTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVSHFVPEKPMYEQGLILLPH IATLGYGVGPGGEIIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESYPFFGYVWKDKNKMTNILGYHLIMLGLGAW LLVWKAMYFGGVYDTWAPGGGDVRVITNPTTNAAVIFGYLVKSPFGGDGWICSVDNMEDIIGGHIWIGTLEILGGIWHIYTT PWPWARRAFVWSGEAYLSYSLGAIGVMGFIACCMSWFNNTAYPSEFYGPTGPEASQSQAFTFLVRDQRLGANVASAQG PTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVA TEINAVNFVSPRSWLACSHFCLGFFFFIGHLWHAGRARAAAAGFEKGIDRFDEPVLSMRPLD

psbA
Mass: 30kDa
Sequence:
MTAILERRENSSLWARFCEWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVIPTSNA IGLHFYPIWEAASLDEWLYNGGPYQLIVCHFLLGVYCYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFLVYPIGQGSFSD GMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAH GYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGLSTMAFNLNGFNFNQSVVDSQGRVLNTWADIINRANLGMEVMHE
RNAHNFPLDLASTNSSSNN

References

[1] Kim M, Christopher DA, Mullet JE. ADP-Dependent Phosphorylation Regulates Association of a DNA-Binding Complex with the Barley Chloroplast psbDBlue-Light-Responsive Promoter. Plant physiology. 1999 Feb 1;119(2):663-70.

[2] Rasmussen OF, Bookjans G, Stummann BM, Henningsen KW. Localization and nucleotide sequence of the gene for the membrane polypeptide D2 from pea chloroplast DNA. Plant molecular biology. 1984 Jul 1;3(4):191-9.

[3] Erickson JM, Rahire M, Malnoë P, Girard-Bascou J, Pierre Y, Bennoun P, Rochaix JD. Lack of the D2 protein in a Chlamydomonas reinhardtii psbD mutant affects photosystem II stability and D1 expression. The EMBO journal. 1986 Aug;5(8):1745.

[4] Bricker TM, Frankel LK. The structure and function of CP47 and CP43 in photosystem II. Photosynthesis research. 2002 May 1;72(2):131-46.

[5] Vermaas WF, Ikeuchi M, Inoue Y. Protein composition of the photosystem II core complex in genetically engineered mutants of the cyanobacterium Synechocystis sp. PCC 6803. InMolecular Biology of Photosynthesis 1988 (pp. 389-405). Springer Netherlands.

[6] Marder JB, Chapman DJ, Telfer A, Nixon PJ, Barber J. Identification of psbA and psbD gene products, D1 and D2, as reaction centre proteins of photosystem 2. Plant molecular biology. 1987 Jul 1;9(4):325-33.

[7] Ferreira KN, Iverson TM, Maghlaoui K, Barber J, Iwata S. Architecture of the photosynthetic oxygen-evolving center. Science. 2004 Mar 19;303(5665):1831-8.