Difference between revisions of "Part:BBa K1998000"
SWinchester (Talk | contribs) |
|||
| Line 3: | Line 3: | ||
<partinfo>BBa_K1998000 short</partinfo> | <partinfo>BBa_K1998000 short</partinfo> | ||
| + | <!-- --> | ||
| + | <span class='h3bb'>Sequence and Features</span> | ||
| + | <partinfo>BBa_K1998000 SequenceAndFeatures</partinfo> | ||
| + | <!-- Uncomment this to enable Functional Parameter display | ||
| + | ===Functional Parameters=== | ||
| + | <partinfo>BBa_K1998000 parameters</partinfo> | ||
| + | <!-- --> | ||
| + | |||
| + | ===Overview=== | ||
This composite part is made up of various genes that form a part of the chlorophyll biosynthesis pathway. ChlI1 and ChlI2 forms a Mg-chelatase complex which catalyzes the insertion of magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX. ChID forms an ATP dependent complex with ChlI1 and ChlI2 before acting of protoporphyrin. GUN4 is a tetrapyrrole-binding protein which controls the production of Mg-protoporphyrin IX found only in aerobic photsynthetic organisms. It is thought to participate in plastid-to-nucleus signalling by regulating Mg-protoporphyrin IX synthesis. Finally, ChlH is a chloroplast precursor which plays a role in the regulation of light in chlorophyll biosynthesis. | This composite part is made up of various genes that form a part of the chlorophyll biosynthesis pathway. ChlI1 and ChlI2 forms a Mg-chelatase complex which catalyzes the insertion of magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX. ChID forms an ATP dependent complex with ChlI1 and ChlI2 before acting of protoporphyrin. GUN4 is a tetrapyrrole-binding protein which controls the production of Mg-protoporphyrin IX found only in aerobic photsynthetic organisms. It is thought to participate in plastid-to-nucleus signalling by regulating Mg-protoporphyrin IX synthesis. Finally, ChlH is a chloroplast precursor which plays a role in the regulation of light in chlorophyll biosynthesis. | ||
| − | |||
CTH1 is a functional protein that is developed in the prescense of oxygen or copper. It catalyzes Mg-protoporphyrin IX monomethyl, which converts to divinyl protochlorophyllide in the presence of NADPH and O2. | CTH1 is a functional protein that is developed in the prescense of oxygen or copper. It catalyzes Mg-protoporphyrin IX monomethyl, which converts to divinyl protochlorophyllide in the presence of NADPH and O2. | ||
| + | This biobrick contains six genes from the chlorophyll biosynthetic pathway of Chlamydomonas reinhardtii. These genes are Magnesium chelatase subunit H (ChlH), Magnesium chelatase subunit I (Chli1/Chli2), Magnesium chelatase subunit D (ChlD), Genomes uncoupled 4 (GUN4) and Copper target 1 protein (Cth1). These genes are involved in converting protoporphyrin IX to divinyl protochlorophyllide in the presence of NADPH and O2. | ||
| − | |||
| − | |||
| − | < | + | <br><br> |
| − | < | + | <html><center><img src="https://static.igem.org/mediawiki/2016/0/0f/T--Macquarie_Australia--ChlorophyllBiosynthesisDiagram.png" alt="ChlorophyllBiosynthesisDiagram" height="50%"width="75%"></center></html> |
| − | < | + | |
| + | ===Biology & Literature=== | ||
| − | + | ||
| − | === | + | ===Protein information=== |
| − | < | + | YCF54<br> |
| − | < | + | mass: 17.08kDa <br> |
| + | sequence: MAPAAASADKATAAEYYALVCNAEWFFMDPQNESVAEQLREKVRFFKEQN KERDFFIVPNPKWLDAKFPEQAKQVKRPCVALVSTDKMWITFMKLRLDRV LKIDLKSMPASEVLAAGEALPDFKPDGKWTAPYARYTPGWWNVFLPNH <br> | ||
| + | <br><br> | ||
| + | ChlM<br> | ||
| + | mass: 30.45kDa | ||
| + | sequence: MASEIAQTADVGSLTFAVGGVGAVVGLGALLVATDHQKRRSEQMKSFDGD EKEAVKDYFNTAGFERWRKIYGETDEVNKVQLDIRTGHAQTVDKVLRWVD EEGSVQGITVADCGCGTGSLAIQLALRGAAVSASDISAAMASEAEQRYQQ AVAAGQGKAPKVAPKFEALDLESVKGKYDTVTCLDVMIHYPQDKVDAMIT HLAGLSDRRLIISFAPKTLSYSILKRIGELFPGPSKATRAYLHREEDVEAALK | ||
| + | RAGFKVTKREMTATSFYFSRLLEAIRE | ||
| + | <br><br> | ||
| + | |||
| + | ===References=== | ||
Revision as of 00:58, 19 October 2016
Mg-Chelatase Plasmid
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12INCOMPATIBLE WITH RFC[12]Illegal NheI site found at 4753
Illegal NotI site found at 2666
Illegal NotI site found at 4213 - 21INCOMPATIBLE WITH RFC[21]Illegal BglII site found at 439
Illegal BglII site found at 1095
Illegal BglII site found at 1290
Illegal BglII site found at 3371
Illegal BglII site found at 3898
Illegal BglII site found at 5755
Illegal BglII site found at 5863
Illegal BamHI site found at 487 - 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 1946
Illegal NgoMIV site found at 2765
Illegal NgoMIV site found at 3307
Illegal NgoMIV site found at 7968
Illegal AgeI site found at 6853
Illegal AgeI site found at 6883
Illegal AgeI site found at 7777
Illegal AgeI site found at 7945
Illegal AgeI site found at 9463
Illegal AgeI site found at 9517
Illegal AgeI site found at 9736 - 1000INCOMPATIBLE WITH RFC[1000]Illegal BsaI.rc site found at 5553
Illegal BsaI.rc site found at 5709
Illegal BsaI.rc site found at 6330
Illegal BsaI.rc site found at 9862
Illegal SapI.rc site found at 7219
Illegal SapI.rc site found at 9792
Overview
This composite part is made up of various genes that form a part of the chlorophyll biosynthesis pathway. ChlI1 and ChlI2 forms a Mg-chelatase complex which catalyzes the insertion of magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX. ChID forms an ATP dependent complex with ChlI1 and ChlI2 before acting of protoporphyrin. GUN4 is a tetrapyrrole-binding protein which controls the production of Mg-protoporphyrin IX found only in aerobic photsynthetic organisms. It is thought to participate in plastid-to-nucleus signalling by regulating Mg-protoporphyrin IX synthesis. Finally, ChlH is a chloroplast precursor which plays a role in the regulation of light in chlorophyll biosynthesis.
CTH1 is a functional protein that is developed in the prescense of oxygen or copper. It catalyzes Mg-protoporphyrin IX monomethyl, which converts to divinyl protochlorophyllide in the presence of NADPH and O2.
This biobrick contains six genes from the chlorophyll biosynthetic pathway of Chlamydomonas reinhardtii. These genes are Magnesium chelatase subunit H (ChlH), Magnesium chelatase subunit I (Chli1/Chli2), Magnesium chelatase subunit D (ChlD), Genomes uncoupled 4 (GUN4) and Copper target 1 protein (Cth1). These genes are involved in converting protoporphyrin IX to divinyl protochlorophyllide in the presence of NADPH and O2.
Biology & Literature
Protein information
YCF54
mass: 17.08kDa
sequence: MAPAAASADKATAAEYYALVCNAEWFFMDPQNESVAEQLREKVRFFKEQN KERDFFIVPNPKWLDAKFPEQAKQVKRPCVALVSTDKMWITFMKLRLDRV LKIDLKSMPASEVLAAGEALPDFKPDGKWTAPYARYTPGWWNVFLPNH
ChlM
mass: 30.45kDa
sequence: MASEIAQTADVGSLTFAVGGVGAVVGLGALLVATDHQKRRSEQMKSFDGD EKEAVKDYFNTAGFERWRKIYGETDEVNKVQLDIRTGHAQTVDKVLRWVD EEGSVQGITVADCGCGTGSLAIQLALRGAAVSASDISAAMASEAEQRYQQ AVAAGQGKAPKVAPKFEALDLESVKGKYDTVTCLDVMIHYPQDKVDAMIT HLAGLSDRRLIISFAPKTLSYSILKRIGELFPGPSKATRAYLHREEDVEAALK
RAGFKVTKREMTATSFYFSRLLEAIRE