Difference between revisions of "Part:BBa K1998013"
SWinchester (Talk | contribs) |
SWinchester (Talk | contribs) (→Biology & Literature) |
||
| Line 23: | Line 23: | ||
===Biology & Literature=== | ===Biology & Literature=== | ||
| − | + | The first gene, YCF54, works with the CTH1 gene and Plastocyanin within the oxidative cyclase pathway. It's interaction with other genes results in the catalysis of the biosynthesis pathway from Mg-protoporphyrin IX to Protochlorophyllide [1]. Deletion studies have detected the importance of YCF54 in maintaining levels of Mg-protoporphyrin IX methyl ester indicating that the YCF54 gene is critical to both the assembly and function of the cyclase complex [1]. | |
| − | <br> | + | <br><br> |
The second gene in this part is ChlM. ChlM encodes for a magnesium protoporhyrin IX methytransferase. ChlM's role in the pathway is to methylate Mg-protoporphyrin IX which then aids the catalysis of Mg-cheltase [2]. This then facilitates the formation of the final protochlorophyllide. Involved in the second step of the pathway, the ChlM gene is involved in the transfer of a methyl group onto one of the rings of magnesium protoporphyrin which forms the magnesium prootoporhyrin IX monomethylester [3, 4]. | The second gene in this part is ChlM. ChlM encodes for a magnesium protoporhyrin IX methytransferase. ChlM's role in the pathway is to methylate Mg-protoporphyrin IX which then aids the catalysis of Mg-cheltase [2]. This then facilitates the formation of the final protochlorophyllide. Involved in the second step of the pathway, the ChlM gene is involved in the transfer of a methyl group onto one of the rings of magnesium protoporphyrin which forms the magnesium prootoporhyrin IX monomethylester [3, 4]. | ||
| − | <br> | + | <br><br> |
The POR gene is a light dependent protochlorophyllidereductase. It's role is to convert protochlorophyllide to chlorophyllide using NADPH and light as the reductant. Formation of the POR protein in plants is important as without it the chloroplasts do not function [5, 6]. The protochlorophyllide reduces to chlorophyllide by being excited through light functioning as a catalysis. The excitation of the POR molecule and therefore the transformation of it to chlorophyllide cause the conversion of the membranes from an inactive state into active chloroplast [7]. Through this transformation into active chloroplasts, energy is produced and now able to be used by the plant. | The POR gene is a light dependent protochlorophyllidereductase. It's role is to convert protochlorophyllide to chlorophyllide using NADPH and light as the reductant. Formation of the POR protein in plants is important as without it the chloroplasts do not function [5, 6]. The protochlorophyllide reduces to chlorophyllide by being excited through light functioning as a catalysis. The excitation of the POR molecule and therefore the transformation of it to chlorophyllide cause the conversion of the membranes from an inactive state into active chloroplast [7]. Through this transformation into active chloroplasts, energy is produced and now able to be used by the plant. | ||
| − | <br> | + | <br><br> |
Geranylgeranyl reductase - ChlP is a hydrogenase enzyme that reduces the double bonds of geranylgeranyl diphosphate to form phytol pyrophosphate | Geranylgeranyl reductase - ChlP is a hydrogenase enzyme that reduces the double bonds of geranylgeranyl diphosphate to form phytol pyrophosphate | ||
3,8-divinyl protochlorophyllidea 8-vinyl reductase - DVR1 reduces divinyl protochlorophyllide a to monovinyl protochlorophyllide a | 3,8-divinyl protochlorophyllidea 8-vinyl reductase - DVR1 reduces divinyl protochlorophyllide a to monovinyl protochlorophyllide a | ||
| − | |||
| − | |||
Chlorophyll synthetase - ChlG catalyses the esterification of chlorophyllide with phytyl-pyrophosphate or geranyl-geranyl pyrophosphate in chloroplasts, producing chlorophyll | Chlorophyll synthetase - ChlG catalyses the esterification of chlorophyllide with phytyl-pyrophosphate or geranyl-geranyl pyrophosphate in chloroplasts, producing chlorophyll | ||
Revision as of 23:44, 18 October 2016
MgPPIX to Chlorophyll a plasmid
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21INCOMPATIBLE WITH RFC[21]Illegal BglII site found at 912
Illegal BglII site found at 2365
Illegal BglII site found at 5647
Illegal BglII site found at 6136
Illegal BamHI site found at 316
Illegal BamHI site found at 3128
Illegal BamHI site found at 5416 - 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal AgeI site found at 1904
Illegal AgeI site found at 1955 - 1000INCOMPATIBLE WITH RFC[1000]Illegal BsaI site found at 478
Illegal BsaI.rc site found at 4018
Overview
This composite part makes up one of our operons in the chlorophyll biosynthesis pathway. It is composed of YCF54, ChlM, POR, DVR1, ChlP and ChlG. These genes are Mg-protoporphyrin IX monomethyl ester (oxidative) cyclase (YCF54) and Magnesium-protoporphyrin O-methyltransferase (ChlM), Light-dependent protochlorophyllidereductase (POR), 3,8-divinyl, Geranylgeranyl reductase(ChlP), protochlorophyllidea 8-vinyl reductase (DVR1) and Chlorophyll synthetase (ChlG).
These genes are part of the chlorophyll biosynthetic pathway and are involved in converting Mg-protoporphyrin IX to chlorophyll
Biology & Literature
The first gene, YCF54, works with the CTH1 gene and Plastocyanin within the oxidative cyclase pathway. It's interaction with other genes results in the catalysis of the biosynthesis pathway from Mg-protoporphyrin IX to Protochlorophyllide [1]. Deletion studies have detected the importance of YCF54 in maintaining levels of Mg-protoporphyrin IX methyl ester indicating that the YCF54 gene is critical to both the assembly and function of the cyclase complex [1].
The second gene in this part is ChlM. ChlM encodes for a magnesium protoporhyrin IX methytransferase. ChlM's role in the pathway is to methylate Mg-protoporphyrin IX which then aids the catalysis of Mg-cheltase [2]. This then facilitates the formation of the final protochlorophyllide. Involved in the second step of the pathway, the ChlM gene is involved in the transfer of a methyl group onto one of the rings of magnesium protoporphyrin which forms the magnesium prootoporhyrin IX monomethylester [3, 4].
The POR gene is a light dependent protochlorophyllidereductase. It's role is to convert protochlorophyllide to chlorophyllide using NADPH and light as the reductant. Formation of the POR protein in plants is important as without it the chloroplasts do not function [5, 6]. The protochlorophyllide reduces to chlorophyllide by being excited through light functioning as a catalysis. The excitation of the POR molecule and therefore the transformation of it to chlorophyllide cause the conversion of the membranes from an inactive state into active chloroplast [7]. Through this transformation into active chloroplasts, energy is produced and now able to be used by the plant.
Geranylgeranyl reductase - ChlP is a hydrogenase enzyme that reduces the double bonds of geranylgeranyl diphosphate to form phytol pyrophosphate
3,8-divinyl protochlorophyllidea 8-vinyl reductase - DVR1 reduces divinyl protochlorophyllide a to monovinyl protochlorophyllide a
Chlorophyll synthetase - ChlG catalyses the esterification of chlorophyllide with phytyl-pyrophosphate or geranyl-geranyl pyrophosphate in chloroplasts, producing chlorophyll
Protein information
YCF54
Mass: 17.08kDa
Sequence:
MAPAAASADKATAAEYYALVCNAEWFFMDPQNESVAEQLREKVRFFKEQNKERDFFIVPNPKWLDAKFPEQAKQVKRPCVALVSTDKMWITFMKLRLDRVLKIDLKSM
PASEVLAAGEALPDFKPDGKWTAPYARYTPGWWNVFLPNH
ChlM
Mass: 30.45kDa
Sequence:
MASEIAQTADVGSLTFAVGGVGAVVGLGALLVATDHQKRRSEQMKSFDGDEKEAVKDYFNTAGFERWRKIYGETDEVNKVQLDIRTGHAQTVDKVLRWVDEEGSVQGIT
VADCGCGTGSLAIQLALRGAAVSASDISAAMASEAEQRYQQAVAAGQGKAPKVAPKFEALDLESVKGKYDTVTCLDVMIHYPQDKVDAMITHLAGLSDRRLIISFAPKTL
SYSILKRIGELFPGPSKATRAYLHREEDVEAALKRAGFKVTKREMTATSFYFSRLLEAIRE
POR
Mass: 41.87kDa
Sequence:
MVVCAATATAPSPSLADKFKPNAIARVPATQQKQTAIITGASSGLGLNAAKALAATGEWHVVMACRDFLKAEQAAKKVGMPAGSYSILHLDLSSLESVRQFVQNFKASGR
RLDALVCNAAVYLPTAKEPRFTADGFELSVGTNHLGHFLLTNLLLDDLKNAPNKQPRCIIVGSITGNTNTLAGNVPPKANLGDLSGLAAGVPAANPMMDGQEFNGAKAYK
DSKVACMMTV RQMHQRFHDATGITFASLYPGCIAETGLFREHVPLFKTLFPPFQKYITKGYVSEEEAGRRLAAVISDPKLNKSGAYWSWSSTTGSFDNK
DVR1
Mass: 37kDa
Sequence:
MAMAASRQAVRVAAAVDADYRKREPKDVRVLVVGPTGYIGKFVVKELVSRGYNVVAFARENAGIKGKMGREDIVKEFHGAEVRFGSVLDPASLRDVAFKDPVDVVVSCLA
SRTGGKKDSWLIDYTATKNSLDVARASGAKHFVLLSAICVQKPLLEFQKAKLQFESDLQAAGDITYSIVRPTAFFKSIAGQIDIVKKGNPYVMFGDGNLAACKPISEADLASF
IADCVTEQNKVNKVLPIGGPSKAFTAKQQADLLFNITGLPPKYFPVPVALMDGMIGLFDSLAKLFPQLEDSAEFARIGKYYATESMLVYDEARGVYRKTKRLVTARTRWKTS
SLVQ
ChlP
Mass: 47kDa
Sequence:
MVIGGGPSGACAAETLAKGGVETFLLERKLDNCKPCGGAIPLCMVEEFDLPMEIIDRRVTKMKMISPSNREVDVGKTLSETEWIGMCRREVFDDYLRNRAQKLGANIVNGL
FMRSEQQSAEGPFTIHYNSYEDGSKMGKPATLEVDMIIGADGANSRIAKEIDAGEYDYAIAFQERIRIPDDKMKYYENLAEMYVGDDVSPDFYGWVFPKYDHVAVGTGTVVN
KTAIKQYQQATRDRSKVKTEGGKIIRVEAHPIPEHPRPRRCKGRVALVGDAAGYVTKCSGEGIYFAAKSGRMAAEAIVEGSANGTKMCGEDAIRVYLDKWDRKYWTTYKVLD
ILQKVFYRSNPAREAFVELCEDSYVQKMTFDSYLYKTVVPGNPLDDVKLLVRTVSSILRSNALRSVNSKSVNVSFGSKANEERVM
AA
ChlG
Mass: 36.84kDa
Sequence:
MNQQATEEKSDTNSAARQMLGMKGAALETDIWKIRVQLTKPVTWIPLIWGVACGAAASGHYQWNNPTQIAQLLTCMMMSGPFLTGYTQTINDWYDREIDAINEPYRPIPS GRISERDVIVQIWVLLLGGIGLAYTLDQWAGHTTPVMLQLTIFGSFISYIYSAPPLKLKQSGWAGNYALGSSYIALPWWAGQALFGTLTLDVMALTIAYSLAGLGIAIVNDFKSI
EGDRQ MGLQSLPVAFGVDTAKWICVSTIDVTQLGVAAYLAWGLHEELYGAVLLALILPQIYFQYKYFLPDPIANDVKYQASAQPFLVFGLLTAGLACGHHVNAVAA
AASAAGAL
References
[1] Hollingshead S, Kopečná J, Jackson PJ, Canniffe DP, Davison PA, Dickman MJ, Sobotka R, Hunter CN. Conserved chloroplast open-reading frame ycf54 is required for activity of the magnesium protoporphyrin monomethylester oxidative cyclase in Synechocystis PCC 6803. Journal of Biological Chemistry. 2012 Aug 10;287(33):27823-33.
[2] Alawady A, Reski R, Yaronskaya E, Grimm B. Cloning and expression of the tobacco CHLM sequence encoding Mg protoporphyrin IX methyltransferase and its interaction with Mg chelatase. Plant molecular biology. 2005 Mar 1;57(5):679-91.
[3] Shepherd M, McLean S, Hunter CN. Kinetic basis for linking the first two enzymes of chlorophyll biosynthesis. FEBS Journal. 2005 Sep 1;272(17):4532-9.
[4] Meinecke L, Alawady A, Schroda M, Willows R, Kobayashi MC, Niyogi KK, Grimm B, Beck CF. Chlorophyll-deficient mutants of Chlamydomonas reinhardtii that accumulate magnesium protoporphyrin IX. Plant molecular biology. 2010 Apr 1;72(6):643-58.
[5] Fujita Y. Protochlorophyllide reduction: a key step in the greening of plants. Plant and cell physiology. 1996 Jun 1;37(4):411-21.
[6] Darrah PM, Kay SA, Teakle GR, Griffiths WT. Cloning and sequencing of protochlorophyllide reductase. Biochemical Journal. 1990 Feb 1;265(3):789-98.
[7] Griffiths WT. Characterization of the terminal stages of chlorophyll (ide) synthesis in etioplast membrane preparations. Biochemical Journal. 1975 Dec 1;152(3):623-55.