Difference between revisions of "Part:BBa K1998004"
Line 22: Line 22:
 
===Biology & Literature===
 
===Biology & Literature===
  
−
PsbM encodes a highly hydrophobic protein, psbM, with a single, membrane spanning α-helix located at the monomer-monomer interface of PSII (Ferreira, Iverson, Maghlaoui, Barber, & Iwata, 2004). This proteins acts to stabilise the dimerization of PSII. While not a necessary factor for PSII biosynthesis, its absence weakens the dimer interconnection of the core complex, and may impair PSII repair (Umate et al., 2007). Deletion studies of this gene have shown a 28% decrease in successfully assembled PSII centres (Bentley, Luo, Dilbeck, Burnap, & Eaton-Rye, 2008).
+
The first gene in this operon is psbM which acts to stabalise the dimerisation of the PSII complex through it's span over the membrane by way on an α-helix located at the monomer-monomer interface of PSII [1]. It has been shown that it's absence will weaker the dimer interconnection of the core complex and may impair PSII repair, however it is not a necessary factor for PSII biosynthesis [2]. In addition the success of PSII centre assembly decreases when this gene is removed [3].  
−
 
+
<br><br>
−
PsbZ, also referred to as ycf9, is a highly conserved gene amongst photosynthetic species, encoding a two transmembrane helix protein, psbZ (Ferreira et al., 2004). PsbZ is found at the interface between PSII and light harvesting complex II (LHCII). (Minagawa & Takahashi, 2004). Deletion studies of psbZ  have resulted in decreased stability of the PSII-LHCII supercomplex, suggesting this protein is involved in anchoring the two complexes (Swiatek et al., 2001).
+
The psbZ gene is also referred to as ycf9 [4]. The gene highly conserved gene amongst photosynthetic species and interacts with the light harvesting antenna in the PSII complex [4], found close to the PSII interface and light harvesting complex II [5]. The two transmembrane helix protein which it encodes [1], has been indicated to result in decreased stability of the both the PSII and Light Harvesting Complex II if deleted [4]. This suggests that it has a role in anchoring these two complexes.
 +
<br><br>
 +
The second gene in this operon, psbH
  
 
PsbH encodes a low molecular weight PSII subunit, psbH, containing multiple phosphorylation sites (Vener, Harms, Sussman, & Vierstra, 2001). Deletion studies of this gene across multiple species have shown different effects. In Synechocystis sp., a slower growth rate, higher light sensitivity, and impaired electron transport from QA to QB has been observed (Mayes et al., 1993). In addition, the deletion of psbH has been observed to both destabilize the PSII complex, and impair the binding of bicarbonate to the complex (Komenda, Lupínková, & Kopecký, 2002), and in Chlamydomonas reinhardtii, eliminate the formation of the PSII complex, revealing psbH as a vital gene for the synthesis of Photosystem II (Summer, Schmid, Bruns, & Schmidt, 1997).
 
PsbH encodes a low molecular weight PSII subunit, psbH, containing multiple phosphorylation sites (Vener, Harms, Sussman, & Vierstra, 2001). Deletion studies of this gene across multiple species have shown different effects. In Synechocystis sp., a slower growth rate, higher light sensitivity, and impaired electron transport from QA to QB has been observed (Mayes et al., 1993). In addition, the deletion of psbH has been observed to both destabilize the PSII complex, and impair the binding of bicarbonate to the complex (Komenda, Lupínková, & Kopecký, 2002), and in Chlamydomonas reinhardtii, eliminate the formation of the PSII complex, revealing psbH as a vital gene for the synthesis of Photosystem II (Summer, Schmid, Bruns, & Schmidt, 1997).
Line 49: Line 51:
 
mass: 6.02kDa
 
mass: 6.02kDa
 
<br>
 
<br>
−
sequence: MSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLILDDVSMSWETLAKVS
+
sequence: MSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLILDDVSMSWETLAKVS
 
<br><br>
 
<br><br>
  
Line 67: Line 69:
  
 
===References===
 
===References===
−
[1]
+
[1] Ferreira KN, Iverson TM, Maghlaoui K, Barber J, Iwata S. Architecture of the photosynthetic oxygen-evolving center. Science. 2004 Mar 19;303(5665):1831-8.
−
 
+
<br><br>
−
[2]
+
[2] Umate P, Schwenkert S, Karbat I, Dal Bosco C, Mlcòchová L, Volz S, Zer H, Herrmann RG, Ohad I, Meurer J. Deletion of PsbM in tobacco alters the QB site properties and the electron flow within photosystem II. Journal of Biological Chemistry. 2007 Mar 30;282(13):9758-67.
−
 
+
<br><br>
−
[3]
+
[3] Bentley FK, Luo H, Dilbeck P, Burnap RL, Eaton-Rye JJ. Effects of Inactivating psbM and psbT on Photodamage and Assembly of Photosystem II in Synechocystis sp. PCC 6803†. Biochemistry. 2008 Oct 4;47(44):11637-46.
−
 
+
<br><br>
−
[4]
+
[4] Swiatek M, Kuras R, Sokolenko A, Higgs D, Olive J, Cinque G, Müller B, Eichacker LA, Stern DB, Bassi R, Herrmann RG. The chloroplast gene ycf9 encodes a photosystem II (PSII) core subunit, PsbZ, that participates in PSII supramolecular architecture. The Plant Cell. 2001 Jun 1;13(6):1347-68.
−
 
+
<br><br>
−
[5]
+
[5] Minagawa J, Takahashi Y. Structure, function and assembly of Photosystem II and its light-harvesting proteins. Photosynthesis research. 2004 Dec 1;82(3):241-63.
 +
<br><br>
 +
[6]

Revision as of 05:14, 18 October 2016


psbMZHWK

Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    INCOMPATIBLE WITH RFC[25]
    Illegal NgoMIV site found at 570
  • 1000
    COMPATIBLE WITH RFC[1000]


Overview

This part is composed of the psbM, psbZ, psbH, psbW and psbK genes. The psbM protein subunit is positioned at the monomer-monomer interface. The psbZ protein controls the interaction of Photosystem II cores with the light-harvesting antenna. The psbH protein is required for stability and assembly of the photosystem II complex. The psbW protein stabilizes dimeric photosytem II. The psbK protein is also required for stability and assembly of Photosystem II.
These parts make up one of the operons in our PSII pathway.

PhotosystemIISynthesis

Biology & Literature

The first gene in this operon is psbM which acts to stabalise the dimerisation of the PSII complex through it's span over the membrane by way on an α-helix located at the monomer-monomer interface of PSII [1]. It has been shown that it's absence will weaker the dimer interconnection of the core complex and may impair PSII repair, however it is not a necessary factor for PSII biosynthesis [2]. In addition the success of PSII centre assembly decreases when this gene is removed [3].

The psbZ gene is also referred to as ycf9 [4]. The gene highly conserved gene amongst photosynthetic species and interacts with the light harvesting antenna in the PSII complex [4], found close to the PSII interface and light harvesting complex II [5]. The two transmembrane helix protein which it encodes [1], has been indicated to result in decreased stability of the both the PSII and Light Harvesting Complex II if deleted [4]. This suggests that it has a role in anchoring these two complexes.

The second gene in this operon, psbH

PsbH encodes a low molecular weight PSII subunit, psbH, containing multiple phosphorylation sites (Vener, Harms, Sussman, & Vierstra, 2001). Deletion studies of this gene across multiple species have shown different effects. In Synechocystis sp., a slower growth rate, higher light sensitivity, and impaired electron transport from QA to QB has been observed (Mayes et al., 1993). In addition, the deletion of psbH has been observed to both destabilize the PSII complex, and impair the binding of bicarbonate to the complex (Komenda, Lupínková, & Kopecký, 2002), and in Chlamydomonas reinhardtii, eliminate the formation of the PSII complex, revealing psbH as a vital gene for the synthesis of Photosystem II (Summer, Schmid, Bruns, & Schmidt, 1997).


Protein information

psbM
mass: 3.76kDa
sequence: MEVNIYGLTATALFIIIPTSFLLILYVKTASTQD

psbZ
mass: 4.56kDa
sequence: MVGVPVVFATPNGWTDNKGAVFSGLSLWLLLVFVVGILNSFVV

psbH
mass: 6.02kDa
sequence: MSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLILDDVSMSWETLAKVS

psbW
mass: 9.2kDa
sequence: MATTVRSEVAKKVAMLSTLPATLAAHPAFALVDERMNGDGTGRPFGVNDPVLGWVLLGVFGTMWAIWFIGQKDLGDFEDADDGLKL

psbK
mass: 5.0kDa
sequence: MTTLALVLAKLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFR

References

[1] Ferreira KN, Iverson TM, Maghlaoui K, Barber J, Iwata S. Architecture of the photosynthetic oxygen-evolving center. Science. 2004 Mar 19;303(5665):1831-8.

[2] Umate P, Schwenkert S, Karbat I, Dal Bosco C, Mlcòchová L, Volz S, Zer H, Herrmann RG, Ohad I, Meurer J. Deletion of PsbM in tobacco alters the QB site properties and the electron flow within photosystem II. Journal of Biological Chemistry. 2007 Mar 30;282(13):9758-67.

[3] Bentley FK, Luo H, Dilbeck P, Burnap RL, Eaton-Rye JJ. Effects of Inactivating psbM and psbT on Photodamage and Assembly of Photosystem II in Synechocystis sp. PCC 6803†. Biochemistry. 2008 Oct 4;47(44):11637-46.

[4] Swiatek M, Kuras R, Sokolenko A, Higgs D, Olive J, Cinque G, Müller B, Eichacker LA, Stern DB, Bassi R, Herrmann RG. The chloroplast gene ycf9 encodes a photosystem II (PSII) core subunit, PsbZ, that participates in PSII supramolecular architecture. The Plant Cell. 2001 Jun 1;13(6):1347-68.

[5] Minagawa J, Takahashi Y. Structure, function and assembly of Photosystem II and its light-harvesting proteins. Photosynthesis research. 2004 Dec 1;82(3):241-63.

[6]