Difference between revisions of "Part:BBa K1978002"
| Line 11: | Line 11: | ||
===Usage and Biology=== | ===Usage and Biology=== | ||
This BioBrick can be used to test a new organism for compatibility with BioBricks using the standart <i>torA</i> signal sequence from <i>E. coli</i>. | This BioBrick can be used to test a new organism for compatibility with BioBricks using the standart <i>torA</i> signal sequence from <i>E. coli</i>. | ||
| − | <!-- | + | <!-- |
<span class='h3bb'>Sequence and Features</span> | <span class='h3bb'>Sequence and Features</span> | ||
<partinfo>BBa_K1978002 SequenceAndFeatures</partinfo> | <partinfo>BBa_K1978002 SequenceAndFeatures</partinfo> | ||
| Line 20: | Line 20: | ||
<partinfo>BBa_K1978002 parameters</partinfo> | <partinfo>BBa_K1978002 parameters</partinfo> | ||
<!-- --> | <!-- --> | ||
| + | --> | ||
Revision as of 23:09, 17 October 2016
TorA-RFP
The TorA-RFP BioBrick consists of a TorA signal linked to RFP, which is fluorescent protein. The TorA signal sequence allows export of fully-folded proteins through the inner membrane via the TAT(Twin-Arginin Translocation) system. This enables export of RFP out of the cell. The TorA sequence codes for a peptide that harbours a twin-arginine motif. This is vital for the recognition by the Tat system. Moreover, an AxA motif is present, which leads to cleavage by the leader peptidase I (Palmer & Berks 2012). MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA
Usage and Biology
This BioBrick can be used to test a new organism for compatibility with BioBricks using the standart torA signal sequence from E. coli. -->