Difference between revisions of "Part:BBa K1998012"

Revision as of 06:35, 17 October 2016

HydEF

Sequence and Features

Overview

The HydEF protein contains two unique domains that are homologous to two distinct prokaryotic proteins, HydE and HydF, which are found exclusively in organisms containing [Fe] hydrogenase. This part makes up one of the parts found in an operon of the hydrogen production pathway.

[image of hydrogenase system]

Biology & Literature

HydEF (comprising of HydE and HydF) encodes proteins necessary for hydrogenase activity by functioning in H cluster biosynthesis and enzyme maturation involving S-adenosylmethionine (SAM) dependent mechanisms [1]. Hyd F is part of the GTPase protein family, with GTP-binding motifs present at the N terminal end and iron-sulfur cluster-binding motifs at the C terminal end [2]. Both HydE is a radical SAM (S-adenosyl methionine) enzyme [3]. King et al. stated that challenges faced during the expression of maturation genes Hyd EF and Hyd G in E. coli were that they were unstable and prone to rearrangements [1].

Both Hyd EF and Hyd G are transcribed under anaerobic conditions and are necessary for the assembly of an active Hyd A1 hydrogenase [2]. The importance of Hyd EF in hydrogenase activity has also been illustrated in the mutant hydEF-1 strain of C. reinhardtii which is unable to produce H2 due to a non-functional HydEF gene [4].

Protein information

Protein sequence: MAHSLSAHSRQAGDRKLGAGAASSRPSCPSRRIVRVAAHASASKATPDVPVDDLPPAHARAAVAAANRRARAMASAEAAAETLGDFLGLGKGGLSP GATANLDREQVLGVLEAVWRRGDLNLERALYSHANAVTNKYCGGGVYYRGLVEFSNICQNDCSYCGIRNNQKEVWRYTMPVEEVVEVAKWALENGI RNIMLQGGELKTEQRLAYLEACVRAIREETTQLDLEMRARAASTTTAEAAASAQADAEAKRGEPELGVVVSLSVGELPMEQYERLFRAGARRYLIRIET SNPDLYAALHPEPMSWHARVECLRNLKKAGYMLGTGVMVGLPGQTLHDLAGDVMFFRDIKADMIGMGPFITQPGTPATDKWTALYPNANKNSHMK SMFDLTTAMNALVRITMGNVNISATTALQAIIPTGREIALERGANVVMPILTPTQYRESYQLYEGKPCITDTAVQCRRCLDMRLHSVGKTSAAGVWGDPA SFLHPIVGVPVPHDLSSPALAAAASADFHEVGAGPWNPIRLERLVEVPDRYPDPDNHGRKKAGAGKGGKAHDSHDDGDHDDHHHHHGAAPAGAAA GKGTGAAAIGGGAGASRQRVAGAAAASARLCAGARRAGRVVASPLRPAAACRGVAVKAAAAAAGEDAGAGTSGVGSNIVTSPGIASTTAHGVPRINI GVFGVMNAGKSTLVNALAQQEACIVDSTPGTTADVKTVLLELHALGPAKLLDTAGLDEVGGLGDKKRRKALNTLKECDVAVLVVDTDTAAAAIKSGRLA EALEWESKVMEQAHKYNVSPVLLLNVKSRGLPEAQAASMLEAVAGMLDPSKQIPRMSLDLASTPLHERSTITSAFVKEGAVRSSRYGAPLPGCLPRW SLGRNARLLMVIPMDAETPGGRLLRPQAQVMEEAIRHWATVLSVRLDLDAARGKLGPEACEMERQRFDGVIAMMERNDGPTLVVTDSQAIDVVHPW TLDRSSGRPLVPITTFSIAMAYQQNGGRLDPFVEGLEALETLQDGDRVLISEACNHNRITSACNDIGMVQIPNKLEAALGGKKLQIEHAFGREFPELESG GMDGLKLAIHCGGCMIDAQKMQQRMKDLHEAGVPVTNYGVFFSWAAWPDALRRALEPWGVEPPVGTPATPAAAPATAASGV

References

[1] King, P., Posewitz, M., Ghirardi, M. and Seibert, M. (2006). Functional Studies of [FeFe] Hydrogenase Maturation in an Escherichia coli Biosynthetic System. Journal of Bacteriology, 188(6), pp.2163-2172.
[2] Posewitz, M., King, P., Smolinski, S., Zhang, L., Seibert, M. and Ghirardi, M. (2004). Discovery of Two Novel Radical S-Adenosylmethionine Proteins Required for the Assembly of an Active [Fe] Hydrogenase. Journal of Biological Chemistry, 279(24), pp.25711-25720.
[3] Kelly, C., Pinske, C., Murphy, B., Parkin, A., Armstrong, F., Palmer, T. and Sargent, F. (2015). Integration of an [FeFe]-hydrogenase into the anaerobic metabolism of Escherichia coli. Biotechnology Reports, 8, pp.94-104.
[4] Posewitz, M., King, P., Smolinski, S., Smith, R., Ginley, A., Ghirardi, M. and Seibert, M. (2005). Identification of genes required for hydrogenase activity in Chlamydomonas reinhardtii : Figure 1. Biochm. Soc. Trans., 33(1), pp.102-104.