Difference between revisions of "Part:BBa K1415001"
Alex19950425 (Talk | contribs) |
Alex19950425 (Talk | contribs) |
||
Line 2: | Line 2: | ||
<partinfo>BBa_K1415002 short</partinfo> | <partinfo>BBa_K1415002 short</partinfo> | ||
[[File:BM.png|right|300px| ]] | [[File:BM.png|right|300px| ]] | ||
+ | [[File:PCRBM6.png|center|200px| The PCR result of our 9 different kinds of PBAN. Because our PBAN DNA sequence length is around 100~150 bp., the PCR result should be 415~515 bp.]] | ||
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted. | PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted. | ||
https://parts.igem.org/Registry:Feature_requests | https://parts.igem.org/Registry:Feature_requests | ||
Line 19: | Line 20: | ||
Control: Not necessary | Control: Not necessary | ||
[[File:Bombyx mori.png|300px|link=|frameless|right]] | [[File:Bombyx mori.png|300px|link=|frameless|right]] | ||
− | + | ||
<!-- Add more about the biology of this part here | <!-- Add more about the biology of this part here |
Revision as of 06:21, 17 October 2014
PBAN (Mamestra brassicae)
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted. https://parts.igem.org/Registry:Feature_requests
So,if we ligate the constitutive promoter and ribosome binding site,we can make our E.coli produce our special peptides constantly.
Target insect:Silkworm (Bombyx mori)
Spread: the place where farmers want to feed.
Characteristics : It is entirely dependent on humans for its reproduction and does not occur naturally in the wild.
Damage: None
Control: Not necessary
<br
Peptide Sequence: LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 18
- 1000COMPATIBLE WITH RFC[1000]