Difference between revisions of "Part:BBa K1415002"
Line 1: Line 1:
 
__NOTOC__
 
__NOTOC__
 
<partinfo>BBa_K1415002 short</partinfo>
 
<partinfo>BBa_K1415002 short</partinfo>
−
[[File:MB.png|right|300px| ]]
+
<h1>Introduction:PBAN (Pheromone Biosynthesis Activating Neuropeptide)</h1>
  
 +
<div>[[File:SL.png|thumb|right|300px|'''Fig.1-1''' A coding gene of a Spodoptera litura's PBAN ]]</div>
 +
<p style="font-size:120%">'''Mechanism of PBAN'''</p>
 
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.
 
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.
 +
<br><br>
 +
<p style="font-size:120%">'''Features of PBAN'''</p>
 +
'''1. Species-Specific:''' PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with it's targeted receptor, resulting in the production of a particular pheromone.
 +
<br>
 +
'''2. Small Simple Peptide:''' The coding sequence for a PBAN is only around 100 base pairs. To E.coli 100 base pairs is totally within its working capacity. And therefore, E.coli can be our low-cost PBAN factory. By synthesizing the DNA sequences for different PBAN into our factory, we can even produce a variety of PBANs. In addition, this factory is totally environmental friendly, unlike any pesticide we have seen.　
 +
<br>
 +
'''3. Insects' own secretion:''' Because PBAN is a insect's own secretion, insects could not form resistance it. In addition, it can easily trigger pheromone production by coming in contact with its receptor.
 +
<br><br>
 +
'''This part is a coding gene of a Spodoptera litura's PBAN.'''
 +
<br>
 +
See our expanding PBAN(SL) parts collection:
 +
[https://parts.igem.org/Part:BBa_K1415105 Pcons+B0034+PBAN(Spodoptera litura)] and
 +
[https://parts.igem.org/Part:BBa_K1415205 Pcons+B0034+PBAN(Spodoptera litura)+B0034+BFP+J61048 ]
  
−
So,if we ligate the constitutive promoter and ribosome binding site,we can make our E.coli produce our special peptides constantly.
+
[[File:2014NCTUGprotein.jpg|800px|thumb|center|'''Fig.1-2''' Working mechanism of PBAN ]]
 +
<br><br><br>
  
−
<p>Target insect:Cabbage Moth (Mamestra brassicae)</p>
+
ice, PBAN(7、8、9) related construct.
−
 
+
−
<p>Spread: This moths has a natural range across Europe, Asia, and North Africa</p>
+
−
 
+
−
<p>Characteristics: The larva is green, khaki, grey-brown or brown with dark spots. The topside is darker than the bottom side and a yellow or light brown stripe goes round the middle portion by the spots. They grow to about an inch long before pupating, As the common and scientific names suggest.</p>
+
−
 
+
−
<p>Damage: The caterpillar of this species is seen as a pest for commercial agriculture. Often referred to as the "imported cabbageworm" they are a serious pest to cabbage and other mustard family crops. It can also be a pest of cultivated brassicas and sweet peas, but it feeds on a wide range of other plants . Due to its complex life history, this species overwinters either as a larva or a brown pointed oval pupa.</p>
+
−
 
+
−
<br><br><br><br><br>
+
 
[[File:Mamestra brassicae.png|300px|link=|frameless|left]]
 
[[File:Mamestra brassicae.png|300px|link=|frameless|left]]
 
[[File:PCRMB4.png|right|600px| ]]
 
[[File:PCRMB4.png|right|600px| ]]

Revision as of 17:36, 16 October 2014

PBAN (Mamestra brassicae)

Introduction:PBAN (Pheromone Biosynthesis Activating Neuropeptide)

Fig.1-1 A coding gene of a Spodoptera litura's PBAN

Mechanism of PBAN

PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.

Features of PBAN

1. Species-Specific: PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with it's targeted receptor, resulting in the production of a particular pheromone.
2. Small Simple Peptide: The coding sequence for a PBAN is only around 100 base pairs. To E.coli 100 base pairs is totally within its working capacity. And therefore, E.coli can be our low-cost PBAN factory. By synthesizing the DNA sequences for different PBAN into our factory, we can even produce a variety of PBANs. In addition, this factory is totally environmental friendly, unlike any pesticide we have seen.　
3. Insects' own secretion: Because PBAN is a insect's own secretion, insects could not form resistance it. In addition, it can easily trigger pheromone production by coming in contact with its receptor.

This part is a coding gene of a Spodoptera litura's PBAN.
See our expanding PBAN(SL) parts collection: Pcons+B0034+PBAN(Spodoptera litura) and Pcons+B0034+PBAN(Spodoptera litura)+B0034+BFP+J61048

Fig.1-2 Working mechanism of PBAN




ice, PBAN(7、8、9) related construct.

Mamestra brassicae.png
PCRMB4.png




















Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    INCOMPATIBLE WITH RFC[25]
    Illegal NgoMIV site found at 18
  • 1000
    COMPATIBLE WITH RFC[1000]