Difference between revisions of "Part:BBa K1415002"
Alex19950425 (Talk | contribs) |
|||
Line 1: | Line 1: | ||
__NOTOC__ | __NOTOC__ | ||
<partinfo>BBa_K1415002 short</partinfo> | <partinfo>BBa_K1415002 short</partinfo> | ||
− | + | <h1>Introduction:PBAN (Pheromone Biosynthesis Activating Neuropeptide)</h1> | |
+ | <div>[[File:SL.png|thumb|right|300px|'''Fig.1-1''' A coding gene of a Spodoptera litura's PBAN ]]</div> | ||
+ | <p style="font-size:120%">'''Mechanism of PBAN'''</p> | ||
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted. | PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted. | ||
+ | <br><br> | ||
+ | <p style="font-size:120%">'''Features of PBAN'''</p> | ||
+ | '''1. Species-Specific:''' PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with it's targeted receptor, resulting in the production of a particular pheromone. | ||
+ | <br> | ||
+ | '''2. Small Simple Peptide:''' The coding sequence for a PBAN is only around 100 base pairs. To E.coli 100 base pairs is totally within its working capacity. And therefore, E.coli can be our low-cost PBAN factory. By synthesizing the DNA sequences for different PBAN into our factory, we can even produce a variety of PBANs. In addition, this factory is totally environmental friendly, unlike any pesticide we have seen. | ||
+ | <br> | ||
+ | '''3. Insects' own secretion:''' Because PBAN is a insect's own secretion, insects could not form resistance it. In addition, it can easily trigger pheromone production by coming in contact with its receptor. | ||
+ | <br><br> | ||
+ | '''This part is a coding gene of a Spodoptera litura's PBAN.''' | ||
+ | <br> | ||
+ | See our expanding PBAN(SL) parts collection: | ||
+ | [https://parts.igem.org/Part:BBa_K1415105 Pcons+B0034+PBAN(Spodoptera litura)] and | ||
+ | [https://parts.igem.org/Part:BBa_K1415205 Pcons+B0034+PBAN(Spodoptera litura)+B0034+BFP+J61048 ] | ||
− | + | [[File:2014NCTUGprotein.jpg|800px|thumb|center|'''Fig.1-2''' Working mechanism of PBAN ]] | |
+ | <br><br><br> | ||
− | + | ice, PBAN(7、8、9) related construct. | |
− | + | ||
− | + | ||
− | + | ||
− | + | ||
− | + | ||
− | + | ||
− | + | ||
− | + | ||
[[File:Mamestra brassicae.png|300px|link=|frameless|left]] | [[File:Mamestra brassicae.png|300px|link=|frameless|left]] | ||
[[File:PCRMB4.png|right|600px| ]] | [[File:PCRMB4.png|right|600px| ]] |
Revision as of 17:36, 16 October 2014
PBAN (Mamestra brassicae)
Introduction:PBAN (Pheromone Biosynthesis Activating Neuropeptide)
Mechanism of PBAN
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.
Features of PBAN
1. Species-Specific: PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with it's targeted receptor, resulting in the production of a particular pheromone.
2. Small Simple Peptide: The coding sequence for a PBAN is only around 100 base pairs. To E.coli 100 base pairs is totally within its working capacity. And therefore, E.coli can be our low-cost PBAN factory. By synthesizing the DNA sequences for different PBAN into our factory, we can even produce a variety of PBANs. In addition, this factory is totally environmental friendly, unlike any pesticide we have seen.
3. Insects' own secretion: Because PBAN is a insect's own secretion, insects could not form resistance it. In addition, it can easily trigger pheromone production by coming in contact with its receptor.
This part is a coding gene of a Spodoptera litura's PBAN.
See our expanding PBAN(SL) parts collection:
Pcons+B0034+PBAN(Spodoptera litura) and
Pcons+B0034+PBAN(Spodoptera litura)+B0034+BFP+J61048
ice, PBAN(7、8、9) related construct.
Peptide Sequence: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 18
- 1000COMPATIBLE WITH RFC[1000]