Difference between revisions of "Part:BBa K1640021"

(→‎Biology & Literature)
(Updated Biology and Literature section)
Line 22: Line 22:
 
===Biology & Literature===
 
===Biology & Literature===
  
−
This part is composed of psbW and psbK genes. The psbW protein stabilizes dimeric Photosystem II. The psbK protein is also required for stability and assembly of Photosystem II.
+
PsbW encodes psbW, a low molecular weight subunit of photosystem II (PSII), with a molecular mass of 6.1kDa in C. reinhardtii. PsbW is a transmembrane protein involved in PSII dimer-stabilisation and photoprotection. (Woolhead, Mant, Kim, Robinson, & Rodger, 2001). This protein is tightly associated with the PSII reaction centre (Shi & Schröder, 1997), with deletion studies indicating no dimeric PSII complexes present in psbW-less mutants (Shi, Lorković, Oelmüller, & Schröder, 2000). In addition, psbW-less transgenic plants have demonstrated a higher sensitivity to light-based stress (Thidholm, Shi, & Schroder, 2001).
 +
 +
PsbK encodes psbK, a low molecular weight subunit of PSII involved in stabilising the complex, however the necessity of psbK varies between species. In psbK-less C. reinhardtii, the PSII complex was destabilised, with >10% of PSII complex observed, compared to the wild type (Takahashi, Matsumoto, Goldschmidt-Clermont, & Rochaix, 1994). PsbK-less Synechocytis sp., however, only experienced a marginally reduced rate of electron transport and growth (Ikeuchi et al., 1991). In C. reinhardtii, psbK is bound to CP43 (Sugimoto & Takahashi, 2001).
  
 
===Protein information===
 
===Protein information===
Line 40: Line 42:
  
 
===References===
 
===References===
 +
 +
Ikeuchi, M., Eggers, B., Shen, G., Webber, A., Yu, J., Hirano, A., . . . Vermaas, W. (1991). Cloning of the psbK gene from Synechocystis sp. PCC 6803 and characterization of photosystem II in mutants lacking PSII-K. Journal of Biological Chemistry, 266(17), 11111-11115.
 +
 +
Shi, L.-X., Lorković, Z. J., Oelmüller, R., & Schröder, W. P. (2000). The low molecular mass PsbW protein is involved in the stabilization of the dimeric photosystem II complex in Arabidopsis thaliana. Journal of Biological Chemistry, 275(48), 37945-37950.
 +
 +
Shi, L.-X., & Schröder, W. (1997). Compositional and topological studies of the PsbW protein in spinach thylakoid membrane. Photosynthesis Research, 53(1), 45-53. doi:10.1023/A:1005830405809
 +
 +
Sugimoto, I., & Takahashi, Y. (2001). Localization of a small chloroplast-encoded polypeptide PsbK in photosystem II core complex. Science Access, 3(1).
 +
 +
Takahashi, Y., Matsumoto, H., Goldschmidt-Clermont, M., & Rochaix, J.-D. (1994). Directed disruption of the Chlamydomonas chloroplast psbK gene destabilizes the photosystem II reaction center complex. Plant molecular biology, 24(5), 779-788.
 +
 +
Thidholm, E., Shi, L.-X., & Schroder, W. (2001). The PsbW-protien; Its location and involvement in photoinhibition. Science Access, 3(1).
 +
 +
Woolhead, C. A., Mant, A., Kim, S. J., Robinson, C., & Rodger, A. (2001). Conformation of a purified “spontaneously” inserting thylakoid membrane protein precursor in aqueous solvent and detergent micelles. Journal of Biological Chemistry, 276(18), 14607-14613.

Revision as of 00:07, 19 September 2015

psbWK

Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    INCOMPATIBLE WITH RFC[25]
    Illegal NgoMIV site found at 74
  • 1000
    COMPATIBLE WITH RFC[1000]


Overview

This biobrick contains two genes from the photosystem II complex of Chlamydomonas reinhardtii - psbW and psbK, with RBS preceeding each gene, and a terminator at the 3' end.

This part was designed in conjunction with BBa_K1640008, and together they form operon 4 in our set of photosystem II operons:

PSII diagram

Biology & Literature

PsbW encodes psbW, a low molecular weight subunit of photosystem II (PSII), with a molecular mass of 6.1kDa in C. reinhardtii. PsbW is a transmembrane protein involved in PSII dimer-stabilisation and photoprotection. (Woolhead, Mant, Kim, Robinson, & Rodger, 2001). This protein is tightly associated with the PSII reaction centre (Shi & Schröder, 1997), with deletion studies indicating no dimeric PSII complexes present in psbW-less mutants (Shi, Lorković, Oelmüller, & Schröder, 2000). In addition, psbW-less transgenic plants have demonstrated a higher sensitivity to light-based stress (Thidholm, Shi, & Schroder, 2001).

PsbK encodes psbK, a low molecular weight subunit of PSII involved in stabilising the complex, however the necessity of psbK varies between species. In psbK-less C. reinhardtii, the PSII complex was destabilised, with >10% of PSII complex observed, compared to the wild type (Takahashi, Matsumoto, Goldschmidt-Clermont, & Rochaix, 1994). PsbK-less Synechocytis sp., however, only experienced a marginally reduced rate of electron transport and growth (Ikeuchi et al., 1991). In C. reinhardtii, psbK is bound to CP43 (Sugimoto & Takahashi, 2001).

Protein information

psbW

mass: 9.2kDa

sequence: MATTVRSEVAKKVAMLSTLPATLAAHPAFALVDERMNGDGTGRPFGVNDPVLGWVLLGVFGTMWAIWFIGQKDLGDFEDADDGLKL


psbK

mass: 5.0kDa

sequence: MTTLALVLAKLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFR

References

Ikeuchi, M., Eggers, B., Shen, G., Webber, A., Yu, J., Hirano, A., . . . Vermaas, W. (1991). Cloning of the psbK gene from Synechocystis sp. PCC 6803 and characterization of photosystem II in mutants lacking PSII-K. Journal of Biological Chemistry, 266(17), 11111-11115.

Shi, L.-X., Lorković, Z. J., Oelmüller, R., & Schröder, W. P. (2000). The low molecular mass PsbW protein is involved in the stabilization of the dimeric photosystem II complex in Arabidopsis thaliana. Journal of Biological Chemistry, 275(48), 37945-37950.

Shi, L.-X., & Schröder, W. (1997). Compositional and topological studies of the PsbW protein in spinach thylakoid membrane. Photosynthesis Research, 53(1), 45-53. doi:10.1023/A:1005830405809

Sugimoto, I., & Takahashi, Y. (2001). Localization of a small chloroplast-encoded polypeptide PsbK in photosystem II core complex. Science Access, 3(1).

Takahashi, Y., Matsumoto, H., Goldschmidt-Clermont, M., & Rochaix, J.-D. (1994). Directed disruption of the Chlamydomonas chloroplast psbK gene destabilizes the photosystem II reaction center complex. Plant molecular biology, 24(5), 779-788.

Thidholm, E., Shi, L.-X., & Schroder, W. (2001). The PsbW-protien; Its location and involvement in photoinhibition. Science Access, 3(1).

Woolhead, C. A., Mant, A., Kim, S. J., Robinson, C., & Rodger, A. (2001). Conformation of a purified “spontaneously” inserting thylakoid membrane protein precursor in aqueous solvent and detergent micelles. Journal of Biological Chemistry, 276(18), 14607-14613.