Difference between revisions of "Part:BBa K1415006"
Line 106: | Line 106: | ||
<!-- --> | <!-- --> | ||
− | <span class='h3bb' | + | <span class='h3bb'>Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL</span> |
+ | <partinfo>BBa_K1415006 SequenceAndFeatures</partinfo> | ||
Revision as of 14:29, 17 October 2014
PBAN (Helicoverpa armigera Hubner)
Introduction: PBAN (Pheromone Biosynthesis Activating Neuropeptide)
Mechanism of PBAN
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.
Features of PBAN
1. Species-Specific: PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with it's targeted receptor, resulting in the production of a particular pheromone.
2. Small Simple Peptide: The coding sequence for a PBAN is only around 100 base pairs. To E.coli 100 base pairs is totally within its working capacity. And therefore, E.coli can be our low-cost PBAN factory. By synthesizing the DNA sequences for different PBAN into our factory, we can even produce a variety of PBANs. In addition, this factory is totally environmental friendly, unlike any pesticide we have seen.
3. Insects' own secretion: Because PBAN is a insect's own secretion, insects could not form resistance it. In addition, it can easily trigger pheromone production by coming in contact with its receptor.
This part is a coding gene of a Helicoverpa armigera Hubner's PBAN.
See our expanding PBAN(Helicoverpa armigera Hubner) parts collection:
Pcons+B0034+PBAN(Helicoverpa armigera Hubner) and
Pcons+B0034+PBAN(Helicoverpa armigera Hubner)+B0034+BFP+J61048
Ada Rafaeli, Pheromone biosynthesis activating neuropeptide (PBAN): Regulatory role and mode of action, ELSEVIER, General and Comparative Endocrinology 162 (2009) 69–78.
Target insect: Cotton bollworm (Helicoverpa armigera Hubner)
The experiment of PBAN
After receiving the DNA sequences from the gene synthesis company, we recombined each PBAN gene to PSB1C3 backbones and conducted a PCR experiment to check the size of each of the PBANs. The DNA sequence length of the PBAN are around 100~150 bp. In this PCR experiment, the PBAN products size should be near at 415~515 bp. The Fig.2-2 showed the correct size of the PBAN, and proved that we successful ligated the PBAN DNA sequence onto an ideal backbone.
Application of the part
Moreover, to verify that all 9 kinds of PBAN can be expressed by the E.coli, we conducted a SDS protein electrophoresis experiment. We first smashed the E.coli containing the PBAN with a sonicator and then took the supernatant divided from the bacterial pellet by centrifugation. Finally, we used the supernatant to run a SDS protein electrophoresis in a 20 % SDS gel.
Behavior of Target Insects After PBAN Treatment
To investigate what behavior the female moth would show after ingesting PBAN, we put one female moth into a beaker for observation. The beaker is divided into two parts by plastic wrap. The bottom part contains the PBAN solution we prepared, and the upper part is the space for the moth to stay. We soaked cotton that spans the entire length of the beaker with the PBAN solution and sprinkle it with sugar. This way, the moth can suck on the PBAN without drowning in PBAN solution. After all the equipment is set, we put the female moth into the upper part of the beaker. At the time, we started filming as soon as we observed the female moth showing obvious behaviors of sexual stimulation such as flapping their wings. In this observation, the sample moth is Helicoverpa armigera Hubner which we caught in Sunny Morning organic farm. We observed that the moth could absorb the PBAN in the solution through ingestion, and that the PBAN could stimulate the moth's pheromone gland to produce pheromone. As soon as the moth is sexually excited, it would flap its wings rapidly and move its tail slightly upward .
These movies show the behaviors of female moth after ingesting its separate PBANs. The moths clearly became excited and flapped their wings rapidly.
To predict the PBAN expression in E.coli by computer modeling, we next tested PBAN BFP biobricks. We obtained the average expressive value of the blue fluorescence in the biobrick part (above) and also the control part of Pcons + RBS + BFP + Ter. Therefore, we can use the average value to generate predictions of the PBAN expression in E.coli. Below is the blue fluorescence expression curve and bacterial growth curve (OD 600) in a long period of time. We used these data to predict the PBAN expression in E.coli.
modeling
The device we design and working mechanism
Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 18
- 1000COMPATIBLE WITH RFC[1000]