Difference between revisions of "Part:BBa K1415006"

Line 17: Line 17:
 
'''This part is a coding gene of a Spodoptera litura's PBAN.'''
 
'''This part is a coding gene of a Spodoptera litura's PBAN.'''
 
<br>
 
<br>
See our expanding PBAN(SL) parts collection:
+
See our expanding PBAN(HAH) parts collection:
 
[https://parts.igem.org/Part:BBa_K1415106 Pcons+B0034+PBAN(Helicoverpa armigera Hubner)] and
 
[https://parts.igem.org/Part:BBa_K1415106 Pcons+B0034+PBAN(Helicoverpa armigera Hubner)] and
 
[https://parts.igem.org/Part:BBa_K1415206 Pcons+B0034+PBAN(Helicoverpa armigera Hubner)+B0034+BFP+J61048 ]
 
[https://parts.igem.org/Part:BBa_K1415206 Pcons+B0034+PBAN(Helicoverpa armigera Hubner)+B0034+BFP+J61048 ]
Line 65: Line 65:
 
<h1></h1>
 
<h1></h1>
  
[[File:ALLHAH.png|780px|thumb||frameless|center|'''Fig.4-1''' Biobrick of Pcons + RBS + PBAN(SL) + BFP + Term.]]
+
[[File:ALLHAH.png|780px|thumb||frameless|center|'''Fig.4-1''' Biobrick of Pcons + RBS + PBAN(HAH) + BFP + Term.]]
  
 
To predict the PBAN expression in E.coli by computer modeling, we next tested PBAN BFP biobricks. We obtained the average expressive value of the blue fluorescence in the biobrick part (above) and also the control part of Pcons + RBS + BFP + Ter. Therefore, we can use the average value to generate predictions of the PBAN expression in E.coli. Below is the blue fluorescence expression curve and bacterial growth curve (OD 600) in a long period of time. We used these data to predict the PBAN expression in E.coli.  
 
To predict the PBAN expression in E.coli by computer modeling, we next tested PBAN BFP biobricks. We obtained the average expressive value of the blue fluorescence in the biobrick part (above) and also the control part of Pcons + RBS + BFP + Ter. Therefore, we can use the average value to generate predictions of the PBAN expression in E.coli. Below is the blue fluorescence expression curve and bacterial growth curve (OD 600) in a long period of time. We used these data to predict the PBAN expression in E.coli.  
Line 79: Line 79:
  
 
'''modeling'''
 
'''modeling'''
  [[File:MDHAH2.png|780px||thumb|frameless|center|'''Fig.4-5''' Modeling result of Pcons + RBS + PBAN(SL) + BFP + Ter. The blue line is the expression profile of the theoretical biobrick. And the green line is the expression data of Pcons + RBS + PBAN(SL) + BFP + Ter. And the red line is the adjusting line from the green and blue one. This line represent the correcting line of theoretical data and real condition data which can make our model not only fit the theoretical condition but also stay away from experimental bias.]]
+
  [[File:MDHAH2.png|780px||thumb|frameless|center|'''Fig.4-5''' Modeling result of Pcons + RBS + PBAN(HAH) + BFP + Ter. The blue line is the expression profile of the theoretical biobrick. And the green line is the expression data of Pcons + RBS + PBAN(HAH) + BFP + Ter. And the red line is the adjusting line from the green and blue one. This line represent the correcting line of theoretical data and real condition data which can make our model not only fit the theoretical condition but also stay away from experimental bias.]]
  
  

Revision as of 12:55, 17 October 2014

PBAN (Helicoverpa armigera Hubner)

Introduction:PBAN (Pheromone Biosynthesis Activating Neuropeptide)

Fig.1-1 A coding gene of a (Helicoverpa armigera Hubner's PBAN

Mechanism of PBAN

PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.

Features of PBAN

1. Species-Specific: PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with it's targeted receptor, resulting in the production of a particular pheromone.
2. Small Simple Peptide: The coding sequence for a PBAN is only around 100 base pairs. To E.coli 100 base pairs is totally within its working capacity. And therefore, E.coli can be our low-cost PBAN factory. By synthesizing the DNA sequences for different PBAN into our factory, we can even produce a variety of PBANs. In addition, this factory is totally environmental friendly, unlike any pesticide we have seen. 
3. Insects' own secretion: Because PBAN is a insect's own secretion, insects could not form resistance it. In addition, it can easily trigger pheromone production by coming in contact with its receptor.

This part is a coding gene of a Spodoptera litura's PBAN.
See our expanding PBAN(HAH) parts collection: Pcons+B0034+PBAN(Helicoverpa armigera Hubner) and Pcons+B0034+PBAN(Helicoverpa armigera Hubner)+B0034+BFP+J61048

Fig.1-2 Working mechanism of PBAN
Reference:

Ada Rafaeli, Pheromone biosynthesis activating neuropeptide (PBAN): Regulatory role and mode of action, ELSEVIER, General and Comparative Endocrinology 162 (2009) 69–78.




Target insect:Oriental Leafworm Moth (Spodoptera litura)

Fig.2-1 A coding gene of a Spodoptera litura's PBAN


The experiment of PBAN

Fig.2-2 The PCR result of the PBAN-HAH. The DNA sequence length of PBANs are around 100~150 bp, so the PCR products should appear at 415~515 bp.

After receiving the DNA sequences from the gene synthesis company, we recombined each PBAN gene to PSB1C3 backbones and conducted a PCR experiment to check the size of each of the PBANs. The DNA sequence length of the PBAN are around 100~150 bp. In this PCR experiment, the PBAN products size should be near at 415~515 bp. The Fig.1-4 showed the correct size of the PBAN, and proved that we successful ligated the PBAN DNA sequence onto an ideal backbone.























Application of the part

Fig.3-1 Pcon+RBS+PBAN(HAH)

Moreover, to verify that all 9 kinds of PBAN can be expressed by the E.coli, we conducted a SDS protein electrophoresis experiment. We first smashed the E.coli containing the PBAN with a sonicator and then took the supernatant divided from the bacterial pellet by centrifugation. Finally, we used the supernatant to run a SDS protein electrophoresis in a 20 % SDS gel.

Fig.3-2 Protein Electrophoresis of Pcons + RBS + 5 different kinds of PBAN (control: plasmid of Pcons+RBS) Each peptide of PBAN is an around 30 amino acids, so we can see the band of PBANs at 2~4 kDa.

Below are biobrick serial numbers of PBAN abbrevation:

BM: BBa_K1415001   AA: BBa_K1415009   LD: BBa_K1415104

AS: BBa_K1415007   SL: BBa_K1415005

Behavior of Target Insects After PBAN Treatment

To investigate what behavior the female moth would show after ingesting PBAN, we put one female moth into a beaker for observation. The beaker is divided into two parts by plastic wrap. The bottom part contains the PBAN solution we prepared, and the upper part is the space for the moth to stay. We soaked cotton that spans the entire length of the beaker with the PBAN solution and sprinkle it with sugar. This way, the moth can suck on the PBAN without drowning in PBAN solution. After all the equipment is set, we put the female moth into the upper part of the beaker. At the time, we started filming as soon as we observed the female moth showing obvious behaviors of sexual stimulation such as flapping their wings. In this observation, the sample moth is Helicoverpa armigera Hubner which we caught in Sunny Morning organic farm. We observed that the moth could absorb the PBAN in the solution through ingestion, and that the PBAN could stimulate the moth's pheromone gland to produce pheromone. As soon as the moth is sexually excited, it would flap its wings rapidly and move its tail slightly upward .

These movies show the behaviors of female moth after ingesting its separate PBANs. The moths clearly became excited and flapped their wings rapidly.

 






Fig.4-1 Biobrick of Pcons + RBS + PBAN(HAH) + BFP + Term.

To predict the PBAN expression in E.coli by computer modeling, we next tested PBAN BFP biobricks. We obtained the average expressive value of the blue fluorescence in the biobrick part (above) and also the control part of Pcons + RBS + BFP + Ter. Therefore, we can use the average value to generate predictions of the PBAN expression in E.coli. Below is the blue fluorescence expression curve and bacterial growth curve (OD 600) in a long period of time. We used these data to predict the PBAN expression in E.coli.

Fig.4-2 The growth curve of E.coli containing Pcons + RBS + 9 different kinds of PBAN + RBS + BFP + Ter plasmid (control is the competent cells which can not emit blue light).
Fig.4-3 The blue light fluorescence expression curve of E.coli containing Pcons + RBS + 9 different kinds of PBAN + RBS + BFP + Ter plasmid (control is the competent cells which can not emit blue light).
File:Blue light flourescence of 9 different kinds of PBAN(2).png
Fig.4-4 Blue Fluorescence of Pcons + RBS + 9 different kinds of PBAN (control: E.coli containg Pcons+RBS Plasmid). Below are biobrick serial numbers of PBAN abbrevation:</p> SL: BBa_K1415005    BM: BBa_K1415001    MB: BBa_K1415002

AI: BBa_K1415003    LD: BBa_K1415004    HAH:BBa_K1415006

AS: BBa_K1415007    SI: BBa_K1415008    AA: BBa_K1415009


modeling

Fig.4-5 Modeling result of Pcons + RBS + PBAN(HAH) + BFP + Ter. The blue line is the expression profile of the theoretical biobrick. And the green line is the expression data of Pcons + RBS + PBAN(HAH) + BFP + Ter. And the red line is the adjusting line from the green and blue one. This line represent the correcting line of theoretical data and real condition data which can make our model not only fit the theoretical condition but also stay away from experimental bias.


The device we design and working mechanism

Fig.4-6 Our Project Overview.

          

          

modeling of device





Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    INCOMPATIBLE WITH RFC[25]
    Illegal NgoMIV site found at 18
  • 1000
    COMPATIBLE WITH RFC[1000]