Difference between revisions of "Part:BBa K1415006"
Line 62: | Line 62: | ||
[[File:ALLHAH.png|780px|thumb||frameless|center|Fig.3-4-1 Biobrick of Pcons + RBS + PBAN(SL) + BFP + Term.]] | [[File:ALLHAH.png|780px|thumb||frameless|center|Fig.3-4-1 Biobrick of Pcons + RBS + PBAN(SL) + BFP + Term.]] | ||
− | [[File: | + | [[File:Blue_light_flourescence_of_9_different_kinds_of_PBAN (2).jpg|center|650px|thumb|Fig.2-1-7 The growth curve of ''E.coli'' containing Pcons + RBS + 9 different kinds of PBAN + RBS + BFP + Ter plasmid (control is the competent cells which can not emit blue light).]] |
[[File:PBAN_Fluorescence_Value.jpg|thumb|center|650px|Fig.2-1-8 The blue light fluorescence expression curve of ''E.coli'' containing Pcons + RBS + 9 different kinds of PBAN + RBS + BFP + Ter plasmid (control is the competent cells which can not emit blue light).]] | [[File:PBAN_Fluorescence_Value.jpg|thumb|center|650px|Fig.2-1-8 The blue light fluorescence expression curve of ''E.coli'' containing Pcons + RBS + 9 different kinds of PBAN + RBS + BFP + Ter plasmid (control is the competent cells which can not emit blue light).]] | ||
[[File:Blue light flourescence of 9 different kinds of PBAN(2).png|thumb|center|800px| Fig.2-1-5 Blue Fluorescence of Pcons + RBS + 9 different kinds of PBAN (control: ''E.coli'' containg Pcons+RBS Plasmid). Below are biobrick serial numbers of PBAN abbrevation:</p> | [[File:Blue light flourescence of 9 different kinds of PBAN(2).png|thumb|center|800px| Fig.2-1-5 Blue Fluorescence of Pcons + RBS + 9 different kinds of PBAN (control: ''E.coli'' containg Pcons+RBS Plasmid). Below are biobrick serial numbers of PBAN abbrevation:</p> |
Revision as of 06:17, 17 October 2014
PBAN (Helicoverpa armigera Hubner)
Introduction:PBAN (Pheromone Biosynthesis Activating Neuropeptide)
Mechanism of PBAN
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.
Features of PBAN
1. Species-Specific: PBAN is species-specific just like pheromones, meaning that every kind of insect produces specific PBAN that only binds with it's targeted receptor, resulting in the production of a particular pheromone.
2. Small Simple Peptide: The coding sequence for a PBAN is only around 100 base pairs. To E.coli 100 base pairs is totally within its working capacity. And therefore, E.coli can be our low-cost PBAN factory. By synthesizing the DNA sequences for different PBAN into our factory, we can even produce a variety of PBANs. In addition, this factory is totally environmental friendly, unlike any pesticide we have seen.
3. Insects' own secretion: Because PBAN is a insect's own secretion, insects could not form resistance it. In addition, it can easily trigger pheromone production by coming in contact with its receptor.
This part is a coding gene of a Spodoptera litura's PBAN.
See our expanding PBAN(SL) parts collection:
Pcons+B0034+PBAN(Spodoptera litura) and
Pcons+B0034+PBAN(Spodoptera litura)+B0034+BFP+J61048
Target insect:Oriental Leafworm Moth (Spodoptera litura)
The experiment of PBAN
After receiving the DNA sequences from the gene synthesis company, we recombined each PBAN gene to PSB1C3 backbones and conducted a PCR experiment to check the size of each of the PBANs. The DNA sequence length of the PBAN are around 100~150 bp. In this PCR experiment, the PBAN products size should be near at 415~515 bp. The Fig.1-4 showed the correct size of the PBAN, and proved that we successful ligated the PBAN DNA sequence onto an ideal backbone.
Application of the part
The experiment of Pcons+RBS+PBAN-SL
Behavior of Target Insects After PBAN Treatment
The experiment of Pcons+RBS+PBAN-SL+RBS+BFP+Ter
modeling
The device we design and working mechanism
modeling of device
Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 18
- 1000COMPATIBLE WITH RFC[1000]