Difference between revisions of "Part:BBa K1415002"

Revision as of 16:45, 15 October 2014

PBAN (Mamestra brassicae)

PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.

So,if we ligate the constitutive promoter and ribosome binding site,we can make our E.coli produce our special peptides constantly.

Target insect:Cabbage Moth (Mamestra brassicae)

Spread: This moths has a natural range across Europe, Asia, and North Africa

Characteristics: The larva is green, khaki, grey-brown or brown with dark spots. The topside is darker than the bottom side and a yellow or light brown stripe goes round the middle portion by the spots. They grow to about an inch long before pupating, As the common and scientific names suggest.

Damage: The caterpillar of this species is seen as a pest for commercial agriculture. Often referred to as the "imported cabbageworm" they are a serious pest to cabbage and other mustard family crops. It can also be a pest of cultivated brassicas and sweet peas, but it feeds on a wide range of other plants . Due to its complex life history, this species overwinters either as a larva or a brown pointed oval pupa.

Peptide Sequence： LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL