Difference between revisions of "Part:BBa K1415001"

Revision as of 16:38, 15 October 2014

PBAN (Mamestra brassicae)

PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted. https://parts.igem.org/Registry:Feature_requests

So,if we ligate the constitutive promoter and ribosome binding site,we can make our E.coli produce our special peptides constantly.

Target insect:Silkworm (Bombyx mori)

Spread: the place where farmers want to feed.

Characteristics : It is entirely dependent on humans for its reproduction and does not occur naturally in the wild.

Damage: None

Control: Not necessary

Peptide Sequence： LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL Sequence and Features