Difference between revisions of "Part:BBa K2309021"
(One intermediate revision by one other user not shown) | |||
Line 3: | Line 3: | ||
<partinfo>BBa_K2309021 short</partinfo> | <partinfo>BBa_K2309021 short</partinfo> | ||
− | LL-37 is the | + | LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans (Dürr, Sudheendra and Ramamoorthy, 2006). Mature LL-37 has 37 amino acid residues starting with two leucines (NH2-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH).The peptide is cleaved from a larger protein, hCAP-18, by extracellular proteolysis of proteinase 3 from the C-terminal end of hCAP18(Patricia, 2010; Ramos, Domingues, and Gama, 2011).The peptide is composed of two main parts: from residues Leu2 to Leu31, which is a α-helical structure(Fig 2b), and a 6 residues form the loop structure at the terminus. |
+ | Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response in wounds or infection sites, binding and neutralizing lipopolysaccharide (LPS), and wound closure, apart from its anti-microbial property. | ||
+ | |||
+ | ==References== | ||
+ | Dürr, U. H., Sudheendra, U. S., & Ramamoorthy, A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et biophysica acta, 1758(9), 1408–1425. https://doi.org/10.1016/j.bbamem.2006.03.030 | ||
+ | |||
+ | Ramos, R., Silva, J. P., Rodrigues, A. C., Costa, R., Guardão, L., Schmitt, F., Soares, R., Vilanova, M., Domingues, L., & Gama, M. (2011). Wound healing activity of the human antimicrobial peptide LL37. Peptides, 32(7), 1469–1476. https://doi.org/10.1016/j.peptides.2011.06.005 " | ||
<!-- Add more about the biology of this part here | <!-- Add more about the biology of this part here |
Latest revision as of 18:40, 20 October 2020
LL-37 for Lactococcus lactis NZ9000 (codon optimized)
LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans (Dürr, Sudheendra and Ramamoorthy, 2006). Mature LL-37 has 37 amino acid residues starting with two leucines (NH2-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH).The peptide is cleaved from a larger protein, hCAP-18, by extracellular proteolysis of proteinase 3 from the C-terminal end of hCAP18(Patricia, 2010; Ramos, Domingues, and Gama, 2011).The peptide is composed of two main parts: from residues Leu2 to Leu31, which is a α-helical structure(Fig 2b), and a 6 residues form the loop structure at the terminus. Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response in wounds or infection sites, binding and neutralizing lipopolysaccharide (LPS), and wound closure, apart from its anti-microbial property.
References
Dürr, U. H., Sudheendra, U. S., & Ramamoorthy, A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et biophysica acta, 1758(9), 1408–1425. https://doi.org/10.1016/j.bbamem.2006.03.030
Ramos, R., Silva, J. P., Rodrigues, A. C., Costa, R., Guardão, L., Schmitt, F., Soares, R., Vilanova, M., Domingues, L., & Gama, M. (2011). Wound healing activity of the human antimicrobial peptide LL37. Peptides, 32(7), 1469–1476. https://doi.org/10.1016/j.peptides.2011.06.005 "
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25COMPATIBLE WITH RFC[25]
- 1000COMPATIBLE WITH RFC[1000]