Difference between revisions of "Part:BBa K2309021"

 
 
(One intermediate revision by one other user not shown)
Line 3: Line 3:
 
<partinfo>BBa_K2309021 short</partinfo>
 
<partinfo>BBa_K2309021 short</partinfo>
  
LL-37 is the most wildly used anti-microbial peptide which were exist in Homo sapiens. The structure of LL-37 can divide into two parts: alpha helix (1aa-31aa) and the loop structure (32aa-37aa) at the end.  
+
LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans (Dürr, Sudheendra and Ramamoorthy, 2006). Mature LL-37 has 37 amino acid residues starting with two leucines (NH2-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH).The peptide is cleaved from a larger protein, hCAP-18, by extracellular proteolysis of proteinase 3 from the C-terminal end of hCAP18(Patricia, 2010; Ramos, Domingues, and Gama, 2011).The peptide is composed of two main parts: from residues Leu2 to Leu31, which is a α-helical structure(Fig 2b), and a 6 residues form the loop structure at the terminus.
 +
Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response in wounds or infection sites, binding and neutralizing lipopolysaccharide (LPS), and wound closure, apart from its anti-microbial property.
 +
 
 +
==References==
 +
Dürr, U. H., Sudheendra, U. S., & Ramamoorthy, A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et biophysica acta, 1758(9), 1408–1425. https://doi.org/10.1016/j.bbamem.2006.03.030
 +
 
 +
Ramos, R., Silva, J. P., Rodrigues, A. C., Costa, R., Guardão, L., Schmitt, F., Soares, R., Vilanova, M., Domingues, L., & Gama, M. (2011). Wound healing activity of the human antimicrobial peptide LL37. Peptides, 32(7), 1469–1476. https://doi.org/10.1016/j.peptides.2011.06.005  "
  
 
<!-- Add more about the biology of this part here
 
<!-- Add more about the biology of this part here

Latest revision as of 18:40, 20 October 2020


LL-37 for Lactococcus lactis NZ9000 (codon optimized)

LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans (Dürr, Sudheendra and Ramamoorthy, 2006). Mature LL-37 has 37 amino acid residues starting with two leucines (NH2-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH).The peptide is cleaved from a larger protein, hCAP-18, by extracellular proteolysis of proteinase 3 from the C-terminal end of hCAP18(Patricia, 2010; Ramos, Domingues, and Gama, 2011).The peptide is composed of two main parts: from residues Leu2 to Leu31, which is a α-helical structure(Fig 2b), and a 6 residues form the loop structure at the terminus. Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response in wounds or infection sites, binding and neutralizing lipopolysaccharide (LPS), and wound closure, apart from its anti-microbial property.

References

Dürr, U. H., Sudheendra, U. S., & Ramamoorthy, A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et biophysica acta, 1758(9), 1408–1425. https://doi.org/10.1016/j.bbamem.2006.03.030

Ramos, R., Silva, J. P., Rodrigues, A. C., Costa, R., Guardão, L., Schmitt, F., Soares, R., Vilanova, M., Domingues, L., & Gama, M. (2011). Wound healing activity of the human antimicrobial peptide LL37. Peptides, 32(7), 1469–1476. https://doi.org/10.1016/j.peptides.2011.06.005 "

Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    COMPATIBLE WITH RFC[25]
  • 1000
    COMPATIBLE WITH RFC[1000]