Difference between revisions of "Part:BBa K1998003"
SWinchester (Talk | contribs) |
Tom Collier (Talk | contribs) (→Part Verification) |
||
(5 intermediate revisions by 2 users not shown) | |||
Line 14: | Line 14: | ||
===Overview=== | ===Overview=== | ||
− | This biobrick contains one gene from the photosystem II complex of Chlamydomonas reinhardtii - psbD. It is driven by a Plac promoter at the beginning of the sequence, with a RBS preceding the gene, and terminator sequence at the 3' end. The psbD gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core. | + | This biobrick contains one gene from the photosystem II complex of Chlamydomonas reinhardtii - <i>psbD</i>. It is driven by a Plac promoter at the beginning of the sequence, with a RBS preceding the gene, and terminator sequence at the 3' end. The <i>psbD</i> gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core. |
<br><br> | <br><br> | ||
<html><center><img src= "https://static.igem.org/mediawiki/2016/a/aa/T--Macquarie_Australia--PhotosystemIISynthesis.png" alt="PhotosystemIISynthesis" height="50%"width="75%"></center></html> | <html><center><img src= "https://static.igem.org/mediawiki/2016/a/aa/T--Macquarie_Australia--PhotosystemIISynthesis.png" alt="PhotosystemIISynthesis" height="50%"width="75%"></center></html> | ||
===Biology & Literature=== | ===Biology & Literature=== | ||
− | This biobrick contains one gene from the photosystem II complex of <i>Chlamydomonas reinhardtii</i> - psbD. It is driven by a Plac promoter at the beginning of the sequence, with a RBS preceding the gene, and terminator sequence at the 3' end. The psbD gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core P680 [1, 2]. It has been shown that the psbD gene is highly conserved within <i>C. rienhardtii</i> [3]. | + | This biobrick contains one gene from the photosystem II complex of <i>Chlamydomonas reinhardtii</i> - <i>psbD</i>. It is driven by a Plac promoter at the beginning of the sequence, with a RBS preceding the gene, and terminator sequence at the 3' end. The <i>psbD</i> gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core P680 [1, 2]. It has been shown that the <i>psbD</i> gene is highly conserved within <i>C. rienhardtii</i> [3]. |
<br><br> | <br><br> | ||
− | Mutations in the psbD gene causes the D2 peptide to not be visible when screened perhaps indicating it's instability within the complex [3]. In addition it was found that other proteins are affected by a mutation in the psbD gene due to the lack of accumulation of other PSII proteins. Therefore the role of psbD is to provide stability in the membrane of the complex as well as to regulate the expression of the D1 protein of the complex [3]. | + | Mutations in the <i>psbD</i> gene causes the D2 peptide to not be visible when screened perhaps indicating it's instability within the complex [3]. In addition it was found that other proteins are affected by a mutation in the <i>psbD</i> gene due to the lack of accumulation of other PSII proteins. Therefore the role of <i>psbD</i> is to provide stability in the membrane of the complex as well as to regulate the expression of the D1 protein of the complex [3]. |
+ | ===Part Verification=== | ||
+ | |||
+ | <html><centre><img src=" https://static.igem.org/mediawiki/2016/8/82/T--Macquarie_Australia--PSII_Show_Gel_and_.JPG " height="20%" width="40%"></center></html> | ||
+ | <br><br> | ||
+ | <b>Fig 1.</b> Gel electrophoresis of the operons and single parts constituting the Photosystem II pathway implemented in this project. The part psbD (1210 bp) can be seen in lane 6 on the gel at the correct size relative to the 1kb ladder and other parts in our project shown on this gel. The band higher up in this lane on the gel is the pSB1C3 backbone (2000 bp). | ||
===Protein information=== | ===Protein information=== | ||
− | psbD<br> | + | <i>psbD</i><br> |
Mass: 43kDa<br> | Mass: 43kDa<br> | ||
Sequence: <br> | Sequence: <br> | ||
Line 35: | Line 40: | ||
===References=== | ===References=== | ||
− | [1] Kim M, Christopher DA, Mullet JE. ADP-Dependent Phosphorylation Regulates Association of a DNA-Binding Complex with the Barley Chloroplast | + | [1] Kim M, Christopher DA, Mullet JE. ADP-Dependent Phosphorylation Regulates Association of a DNA-Binding Complex with the Barley Chloroplast <i>psbD</i> Blue-Light-Responsive Promoter. Plant physiology. 1999 Feb 1;119(2):663-70. |
<br><br> | <br><br> | ||
[2] Rasmussen OF, Bookjans G, Stummann BM, Henningsen KW. Localization and nucleotide sequence of the gene for the membrane polypeptide D2 from pea chloroplast DNA. Plant molecular biology. 1984 Jul 1;3(4):191-9. | [2] Rasmussen OF, Bookjans G, Stummann BM, Henningsen KW. Localization and nucleotide sequence of the gene for the membrane polypeptide D2 from pea chloroplast DNA. Plant molecular biology. 1984 Jul 1;3(4):191-9. | ||
<br><br> | <br><br> | ||
− | [3] Erickson JM, Rahire M, Malnoë P, Girard-Bascou J, Pierre Y, Bennoun P, Rochaix JD. Lack of the D2 protein in a Chlamydomonas reinhardtii psbD mutant affects photosystem II stability and D1 expression. The EMBO journal. 1986 Aug;5(8):1745. | + | [3] Erickson JM, Rahire M, Malnoë P, Girard-Bascou J, Pierre Y, Bennoun P, Rochaix JD. Lack of the D2 protein in a Chlamydomonas reinhardtii <i>psbD</i> mutant affects photosystem II stability and D1 expression. The EMBO journal. 1986 Aug;5(8):1745. |
Latest revision as of 03:42, 21 October 2016
psbD
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25COMPATIBLE WITH RFC[25]
- 1000COMPATIBLE WITH RFC[1000]
Overview
This biobrick contains one gene from the photosystem II complex of Chlamydomonas reinhardtii - psbD. It is driven by a Plac promoter at the beginning of the sequence, with a RBS preceding the gene, and terminator sequence at the 3' end. The psbD gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core.
![PhotosystemIISynthesis](https://static.igem.org/mediawiki/2016/a/aa/T--Macquarie_Australia--PhotosystemIISynthesis.png)
Biology & Literature
This biobrick contains one gene from the photosystem II complex of Chlamydomonas reinhardtii - psbD. It is driven by a Plac promoter at the beginning of the sequence, with a RBS preceding the gene, and terminator sequence at the 3' end. The psbD gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core P680 [1, 2]. It has been shown that the psbD gene is highly conserved within C. rienhardtii [3].
Mutations in the psbD gene causes the D2 peptide to not be visible when screened perhaps indicating it's instability within the complex [3]. In addition it was found that other proteins are affected by a mutation in the psbD gene due to the lack of accumulation of other PSII proteins. Therefore the role of psbD is to provide stability in the membrane of the complex as well as to regulate the expression of the D1 protein of the complex [3].
Part Verification
Fig 1. Gel electrophoresis of the operons and single parts constituting the Photosystem II pathway implemented in this project. The part psbD (1210 bp) can be seen in lane 6 on the gel at the correct size relative to the 1kb ladder and other parts in our project shown on this gel. The band higher up in this lane on the gel is the pSB1C3 backbone (2000 bp).
Protein information
psbD
Mass: 43kDa
Sequence:
LEGFTLYASGSYVVWKEVKKQLRSVHIKRNAHGSMTLMTGFVKTVSYSVGQVYYYSLVLTLHVVGLVLLSLLHGIRMVLLLTKVVTSQQLFLHLLTVWLTLFYLFGVQKLKVI
SLVGVNLVVYGHSLLYTVHLVLVSCFVSLKLLVQTYVHTTQLLSQHQLLYSFQYSFTHVNQVGSLHLVSVLLSSVSFYSSKVSTTGHLTHSTWVLLVFVLLYYVLFTVLLLKTH
YSKTVTVLTHSVHSTLHRLKKHTLWLLLTVSGHKSSVLLSLTNVGFTSSCYFQLVFGVLLVLVLTYVLTTSYHKRFVLLKNPEFETFYTKKHSSRKVFLAWKGCFRTNHTKRL
VFSKKIYHRGKPSYITNKRRLAIPGKKRARGSHPRALFFQKX
References
[1] Kim M, Christopher DA, Mullet JE. ADP-Dependent Phosphorylation Regulates Association of a DNA-Binding Complex with the Barley Chloroplast psbD Blue-Light-Responsive Promoter. Plant physiology. 1999 Feb 1;119(2):663-70.
[2] Rasmussen OF, Bookjans G, Stummann BM, Henningsen KW. Localization and nucleotide sequence of the gene for the membrane polypeptide D2 from pea chloroplast DNA. Plant molecular biology. 1984 Jul 1;3(4):191-9.
[3] Erickson JM, Rahire M, Malnoë P, Girard-Bascou J, Pierre Y, Bennoun P, Rochaix JD. Lack of the D2 protein in a Chlamydomonas reinhardtii psbD mutant affects photosystem II stability and D1 expression. The EMBO journal. 1986 Aug;5(8):1745.