Difference between revisions of "Part:BBa K1998009"

Latest revision as of 01:24, 9 October 2017

Hyd1

Sequence and Features

Assembly Compatibility:

10
COMPATIBLE WITH RFC[10]
12
INCOMPATIBLE WITH RFC[12]
Illegal NheI site found at 157
21
COMPATIBLE WITH RFC[21]
23
COMPATIBLE WITH RFC[23]
25
COMPATIBLE WITH RFC[25]
1000
COMPATIBLE WITH RFC[1000]

Overview

HYD1 is an oxygen-tolerant hydrogenase; it is a respiratory enzyme that catalyses hydrogen oxidation. It has been suggested that it functions at more positive redox potentials, which are located at the aerobic-anaerobic interface. It forms one of the enzymes found in our hydrogenase pathway of our system.

Biology & Literature

More specifically Hyd1 catalyses the oxidation of hydrogen in the anaerobic respiration of E.coli [2] this done by working in parallel with Hyd 2 before fermentation is undertaken by Hyd3 [2, 3]. Hyd1 is a membrane bound hydrogenase that facilitates the uptake of oxidated hydrogen gas [3]. The hya operon encodes the Hydrogenase peptide which is initiated under anaerobic conditions as well as acidic pH levels which signals that H+ must be facilitated to move from ICF to ECF and viceverser to maintain pH levels in E.coli [3, 4].

Part Verification

Fig 1. A gel consisting of EcorI/PstI double digests for the hydEF part (Lane 4) The hydEF (3611 bp) was observed as expected in the gel.

Protein information

Hyd1
Mass: 53.13 kDa
Sequence:
MSALVLKPCAAVSIRGSSCRARQVAPRAPLAASTVRVALATLEAPARRLGNVACAAAAPAAEAPLSHVQQALAELAKPKDDPTRKHVCVQVAPAVRVAIAETLGLAPGATT PKQLAEGLRRLGFDEVFDTLFGADLTIMEEGSELLHRLTEHLEAHPHSDEPLPMFTSCCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMV SIMPCTRKQSEADRDWFCVDADPTLRQLDHVITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKET NITMVPAPGSKFEELLKHRAAARAEAAAHGTPGPLAWDGGAGFTSEDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKR QAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGVEEKDEKK

References

[1] Nair RR, Emmons MF, Cress AE, Argilagos RF, Lam K, Kerr WT, Wang HG, Dalton WS, Hazlehurst LA. HYD1-induced increase in reactive oxygen species leads to autophagy and necrotic cell death in multiple myeloma cells. Molecular cancer therapeutics. 2009 Aug 1;8(8):2441-51.

[2] Redwood MD, Mikheenko IP, Sargent F, Macaskie LE. Dissecting the roles of Escherichia coli hydrogenases in biohydrogen production. FEMS microbiology letters. 2008 Jan 1;278(1):48-55.

[3] Bisaillon A, Turcot J, Hallenbeck PC. The effect of nutrient limitation on hydrogen production by batch cultures of Escherichia coli. International Journal of Hydrogen Energy. 2006 Sep 30;31(11):1504-8.

[4] Trchounian K, Trchounian A. Hydrogenase 2 is most and hydrogenase 1 is less responsible for H 2 production by Escherichia coli under glycerol fermentation at neutral and slightly alkaline pH. international journal of hydrogen energy. 2009 Nov 30;34(21):8839-45.

@@ Line 13: / Line 13: @@
 ===Overview===
-<br>
 HYD1 is an oxygen-tolerant hydrogenase; it is a respiratory enzyme that catalyses hydrogen oxidation. It has been suggested that it functions at more positive redox potentials, which are located at the aerobic-anaerobic interface. It forms one of the enzymes found in our hydrogenase pathway of our system.
 <br><br>
-[image of hydrogenase system]
+<html><center><img src="https://static.igem.org/mediawiki/parts/b/b5/HydrogenPathwayUpdated2016.jpeg" alt="HydrogenProduction" height="50%"width="75%"></center></html>
 ===Biology & Literature===
-<br>
+More specifically <i>Hyd1</i> catalyses the oxidation of hydrogen in the anaerobic respiration of <i>E.coli</i> [2] this done by working in parallel with <i>Hyd</i> 2 before fermentation is undertaken by <i>Hyd3</i> [2, 3]. <i>Hyd1</i> is a membrane bound hydrogenase that facilitates the uptake of oxidated hydrogen gas [3]. The <i>hya</i> operon encodes the Hydrogenase peptide which is initiated under anaerobic conditions as well as acidic pH levels which signals that H+ must be facilitated to move from ICF to ECF and viceverser to maintain pH levels in <i>E.coli</i> [3, 4].
-Hydrogenase 1 (Hyd1) is a gene which codes for a peptide containing 10 D-amino acids which has been known to induce cell autophagy resulting from an increase in reactive oxygen species and ATP depletion of the cell [1]. Hyd1 has also been known to help treat prostate cancer by preventing the adhesion of carcinomas to the epithelium lining of the digestive tract [2].
-<br>
-<br>
-More specifically Hyd1 catalyses the oxidation of hydrogen in the anaerobic respiration of <i>E.coli</i> this done by working in parallel with Hyd 2 before fermentation is undertaken by Hyd3. Hyd1 is a membrane bound hydrogenase that facilitates the uptake of oxidated hydrogen gas [3]. The hya operon encodes the Hydrogenase peptide which is initiated under anaerobic conditions as well as acidic pH levels which signals that H+ must be facilitated to move from ICF to ECF and viceverser to maintain pH levels in <i>E.coli</i> [4].
 <br>
+===Part Verification===
+<html><center><img src="https://static.igem.org/mediawiki/2016/b/bd/T--Macquarie_Australia--HYDShowGel.png" " width="50%" height="35%"></center> </html>
+<b>Fig 1.</b> A gel consisting of EcorI/PstI double digests for the hydEF part (Lane 4) The hydEF (3611 bp) was observed as expected in the gel.
 ===Protein information===
-<br>
+<i>Hyd1</i><br>
-Protein sequence:
+Mass: 53.13 kDa<br>
-MSALVLKPCAAVSIRGSSCRARQVAPRAPLAASTVRVALATLEAPARRLGNVACAAAAPAAEAPLSHVQQALAELAKPKDDPTRKHVCVQVAPAVRVAIAETLGLAPGATTPKQLAEGLRRLGFDE
+Sequence: <br>
-VFDTLFGADLTIMEEGSELLHRLTEHLEAHPHSDEPLPMFTSCCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMVSIMPCTRKQSEADRDWFCVDADPTLRQLDH
+MSALVLKPCAAVSIRGSSCRARQVAPRAPLAASTVRVALATLEAPARRLGNVACAAAAPAAEAPLSHVQQALAELAKPKDDPTRKHVCVQVAPAVRVAIAETLGLAPGATT
-VITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKETNITMVPAPGSKFEELLKHRAAARAEAAAHGTPGPLAWDGGAGFTS
+PKQLAEGLRRLGFDEVFDTLFGADLTIMEEGSELLHRLTEHLEAHPHSDEPLPMFTSCCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMV
-EDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKRQAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGVEEKDEKK
+SIMPCTRKQSEADRDWFCVDADPTLRQLDHVITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKET
-<br>
+NITMVPAPGSKFEELLKHRAAARAEAAAHGTPGPLAWDGGAGFTSEDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKR
-<br>
+QAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGVEEKDEKK
 <br>
 ===References===
-<br>
+[1] Nair RR, Emmons MF, Cress AE, Argilagos RF, Lam K, Kerr WT, Wang HG, Dalton WS, Hazlehurst LA. HYD1-induced increase in reactive oxygen species leads to autophagy and necrotic cell death in multiple myeloma cells. Molecular cancer therapeutics. 2009 Aug 1;8(8):2441-51.
-[1]
+<br><br>
-<br>
+[2] Redwood MD, Mikheenko IP, Sargent F, Macaskie LE. Dissecting the roles of Escherichia coli hydrogenases in biohydrogen production. FEMS microbiology letters. 2008 Jan 1;278(1):48-55.
-[2]
+<br><br>
-<br>
+[3] Bisaillon A, Turcot J, Hallenbeck PC. The effect of nutrient limitation on hydrogen production by batch cultures of Escherichia coli. International Journal of Hydrogen Energy. 2006 Sep 30;31(11):1504-8.
-[3]
+<br><br>
-<br>
+[4] Trchounian K, Trchounian A. Hydrogenase 2 is most and hydrogenase 1 is less responsible for H 2 production by Escherichia coli under glycerol fermentation at neutral and slightly alkaline pH. international journal of hydrogen energy. 2009 Nov 30;34(21):8839-45.
-[4]
-<br>