Difference between revisions of "Part:BBa K1998002"

 
(→‎Part Verification)
 
(10 intermediate revisions by 3 users not shown)
Line 3: Line 3:
 
<partinfo>BBa_K1998002 short</partinfo>
 
<partinfo>BBa_K1998002 short</partinfo>
  
−
This part is composed of the psbT and psbB genes. The psbT protein's function is not well known however it appears to be involved in the dimerization of Photosystem II  and is essential for photosynthetic activity.
 
  
 
<!-- Add more about the biology of this part here
 
<!-- Add more about the biology of this part here
Line 17: Line 16:
 
<partinfo>BBa_K1998002 parameters</partinfo>
 
<partinfo>BBa_K1998002 parameters</partinfo>
 
<!-- -->
 
<!-- -->
 +
 +
===Overview===
 +
This biobrick contains three genes from the photosystem II complex of Chlamydomonas reinhardtii - <i>psbT</i> and <i>psbB</i>. It is driven by a Plac promoter at the beginning of the sequence, with RBS’s preceding each gene, and terminator sequence at the 3' end.
 +
<br><br>
 +
Parts composed in this operon:<br>
 +
<i>psbT</i> - antenna proteins CP47 <br>
 +
<i>psbB</i> - photosystem II (PSII) chlorophyll-binding protein<br>
 +
These parts form operon 3 in our photosystem II pathway.
 +
<br><br>
 +
<html><center><img src= "https://static.igem.org/mediawiki/2016/a/aa/T--Macquarie_Australia--PhotosystemIISynthesis.png" alt="PhotosystemIISynthesis" height="50%"width="75%"></center></html>
 +
 +
===Biology & Literature===
 +
The second operon begins with <i>psbT</i> followed by <i>psbB</i>. Parts <i>psbT</i> and <i>psbB</i> make up the light harvesting complex inside the photosystem II complex [1]. They have a close interaction with the <i>psbA</i> and <i>psbD</i> complex helping to provide excitation energy from outer complexes onto them [2]. The <i>psbT</i> protein is a hydrophobic peptide that also has a single transmembrane helix which is associated with the PSII core complex [3] which binds to the complexes <i>D1</i> and <i>D2</i> heterodimer [4]. It's location in the core complex is believe to be at the PSII dimer interface [5]. Mutations in the <i>psbT</i> gene indicate that it's expression is not necessarily essential for the function of the PSII complex [4]. The role of <i>psbT</i> in repair of photo-damaged PSII complexes has also been discussed [3]. In addition the <i>psbT</i> gene maintains the stability of QA [5, 6].
 +
<br><br>
 +
The final gene of the composite part is <i>psbB</i>. The <i>psbB</i> protein is associated with the thylakoid membrane and forms part of the inner light harvesting complexes of PSII [7, 8].
 +
 +
===Part Verification===
 +
 +
<html><centre><img src=" https://static.igem.org/mediawiki/2016/8/82/T--Macquarie_Australia--PSII_Show_Gel_and_.JPG " height="20%" width="40%"></center></html>
 +
<br><br>
 +
<b>Fig 1.</b> Gel electrophoresis of the Photosystem II parts, here <i>psbTB</i>  is shown to be the correct size of 1815bp (lane 3) with a cam backbone of 2,070bp, when compaired to 1kb ladder on the gel, which validates the Biobrick parts and backbones.
 +
 +
===Protein information===
 +
<i>psbT</i><br>
 +
mass: 3.6kDa<br>
 +
sequence:<br>
 +
MEALVYTFLLVGTLGIIFFSIFFRDPPRMIK
 +
<br><br>
 +
<i>psbB</i><br>
 +
mass: 56.1kDa<br>
 +
sequence: <br>
 +
MGLPWYRVHTVVINDPGRLISVHLMHTALVSGWAGSMALFEISVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISGETATNPGIWSYEGVAAAHIIL
 +
SGALFLASVWHWTYWDLELFRDPRTGKTALDLPKIFGIHLFLSGLLCFGFGAFHVTGVFGPGIWVSDPYGLTGRVQPVAPSWGADGFDPYNPGGIASHHIAAG
 +
ILGVLAGLFHLCVRPSIRLYFGLSMGSIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIQKRVQASLAEGASLSDAWSRIPEKLAF
 +
YDYIGNNPAKGGLFRTGAMNSGDGIAVGWLGHASFKDQEGRELFVRRMPTFFETFPVLLLDKDGIVRADVPFRKAESKYSIEQVGVSVTFYGGELDGLTFTDP
 +
ATVKKYARKAQLGEIFEFDRSTLQSDGVFRSSPRGWFTFGHVCFALLFFFGHIWHGARTIFRDVFAGIDDDINDQVEFGKYKKLGDTSSLREAF
 +
<br>
 +
 +
===References===
 +
[1] Barber J. Photosystem two. Biochimica et Biophysica Acta (BBA)-Bioenergetics. 1998 Jun 10;1365(1):269-77.
 +
<br><br>
 +
[2] Luciński R, Jackowski G. The structure, functions and degradation of pigment-binding proteins of photosystem II. Acta Biochim Pol. 2006;53(4):693-708.
 +
<br><br>
 +
[3] Monod C, Takahashi Y, Goldschmidt-Clermont M, Rochaix JD. The chloroplast <i>ycf8</i> open reading frame encodes a photosystem II polypeptide which maintains photosynthetic activity under adverse growth conditions. The EMBO journal. 1994 Jun 15;13(12):2747.
 +
<br><br>
 +
[4]Ohnishi N, Takahashi Y. PsbT polypeptide is required for efficient repair of photodamaged photosystem II reaction center. Journal of Biological Chemistry. 2001 Sep 7;276(36):33798-804.
 +
<br><br>
 +
[5] Ferreira KN, Iverson TM, Maghlaoui K, Barber J, Iwata S. Architecture of the photosynthetic oxygen-evolving center. Science. 2004 Mar 19;303(5665):1831-8.
 +
<br><br>
 +
[6] Ohnishi N, Kashino Y, Satoh K, Ozawa SI, Takahashi Y. Chloroplast-encoded polypeptide <i>psbT</i> is involved in the repair of primary electron acceptor QA of photosystem II during photoinhibition in Chlamydomonas reinhardtii. Journal of Biological Chemistry. 2007 Mar 9;282(10):7107-15.
 +
<br><br>
 +
[7] Barber J, Nield J, Morris EP, Zheleva D, Hankamer B. The structure, function and dynamics of photosystem two. Physiologia plantarum. 1997 Aug 1;100(4):817-27.
 +
<br><br>
 +
[8] Bricker TM, Frankel LK. The structure and function of CP47 and CP43 in photosystem II. Photosynthesis research. 2002 May 1;72(2):131-46.

Latest revision as of 03:40, 21 October 2016


psbTB


Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    INCOMPATIBLE WITH RFC[21]
    Illegal BglII site found at 573
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    COMPATIBLE WITH RFC[25]
  • 1000
    COMPATIBLE WITH RFC[1000]


Overview

This biobrick contains three genes from the photosystem II complex of Chlamydomonas reinhardtii - psbT and psbB. It is driven by a Plac promoter at the beginning of the sequence, with RBS’s preceding each gene, and terminator sequence at the 3' end.

Parts composed in this operon:
psbT - antenna proteins CP47
psbB - photosystem II (PSII) chlorophyll-binding protein
These parts form operon 3 in our photosystem II pathway.

PhotosystemIISynthesis

Biology & Literature

The second operon begins with psbT followed by psbB. Parts psbT and psbB make up the light harvesting complex inside the photosystem II complex [1]. They have a close interaction with the psbA and psbD complex helping to provide excitation energy from outer complexes onto them [2]. The psbT protein is a hydrophobic peptide that also has a single transmembrane helix which is associated with the PSII core complex [3] which binds to the complexes D1 and D2 heterodimer [4]. It's location in the core complex is believe to be at the PSII dimer interface [5]. Mutations in the psbT gene indicate that it's expression is not necessarily essential for the function of the PSII complex [4]. The role of psbT in repair of photo-damaged PSII complexes has also been discussed [3]. In addition the psbT gene maintains the stability of QA [5, 6].

The final gene of the composite part is psbB. The psbB protein is associated with the thylakoid membrane and forms part of the inner light harvesting complexes of PSII [7, 8].

Part Verification



Fig 1. Gel electrophoresis of the Photosystem II parts, here psbTB is shown to be the correct size of 1815bp (lane 3) with a cam backbone of 2,070bp, when compaired to 1kb ladder on the gel, which validates the Biobrick parts and backbones.

Protein information

psbT
mass: 3.6kDa
sequence:
MEALVYTFLLVGTLGIIFFSIFFRDPPRMIK

psbB
mass: 56.1kDa
sequence:
MGLPWYRVHTVVINDPGRLISVHLMHTALVSGWAGSMALFEISVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISGETATNPGIWSYEGVAAAHIIL SGALFLASVWHWTYWDLELFRDPRTGKTALDLPKIFGIHLFLSGLLCFGFGAFHVTGVFGPGIWVSDPYGLTGRVQPVAPSWGADGFDPYNPGGIASHHIAAG ILGVLAGLFHLCVRPSIRLYFGLSMGSIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIQKRVQASLAEGASLSDAWSRIPEKLAF YDYIGNNPAKGGLFRTGAMNSGDGIAVGWLGHASFKDQEGRELFVRRMPTFFETFPVLLLDKDGIVRADVPFRKAESKYSIEQVGVSVTFYGGELDGLTFTDP ATVKKYARKAQLGEIFEFDRSTLQSDGVFRSSPRGWFTFGHVCFALLFFFGHIWHGARTIFRDVFAGIDDDINDQVEFGKYKKLGDTSSLREAF

References

[1] Barber J. Photosystem two. Biochimica et Biophysica Acta (BBA)-Bioenergetics. 1998 Jun 10;1365(1):269-77.

[2] Luciński R, Jackowski G. The structure, functions and degradation of pigment-binding proteins of photosystem II. Acta Biochim Pol. 2006;53(4):693-708.

[3] Monod C, Takahashi Y, Goldschmidt-Clermont M, Rochaix JD. The chloroplast ycf8 open reading frame encodes a photosystem II polypeptide which maintains photosynthetic activity under adverse growth conditions. The EMBO journal. 1994 Jun 15;13(12):2747.

[4]Ohnishi N, Takahashi Y. PsbT polypeptide is required for efficient repair of photodamaged photosystem II reaction center. Journal of Biological Chemistry. 2001 Sep 7;276(36):33798-804.

[5] Ferreira KN, Iverson TM, Maghlaoui K, Barber J, Iwata S. Architecture of the photosynthetic oxygen-evolving center. Science. 2004 Mar 19;303(5665):1831-8.

[6] Ohnishi N, Kashino Y, Satoh K, Ozawa SI, Takahashi Y. Chloroplast-encoded polypeptide psbT is involved in the repair of primary electron acceptor QA of photosystem II during photoinhibition in Chlamydomonas reinhardtii. Journal of Biological Chemistry. 2007 Mar 9;282(10):7107-15.

[7] Barber J, Nield J, Morris EP, Zheleva D, Hankamer B. The structure, function and dynamics of photosystem two. Physiologia plantarum. 1997 Aug 1;100(4):817-27.

[8] Bricker TM, Frankel LK. The structure and function of CP47 and CP43 in photosystem II. Photosynthesis research. 2002 May 1;72(2):131-46.