Difference between revisions of "Part:BBa K1640023"
(→Biology & Literature) |
|||
(3 intermediate revisions by 2 users not shown) | |||
Line 13: | Line 13: | ||
===Biology & Literature=== | ===Biology & Literature=== | ||
− | + | PsbO encodes psbO, a 33 kDa protein which acts to stabilise the cluster of four Mn2+ which forms the catalytic centre of the oxygen evolving complex (OEC) (Murata & Miyao, 1985). PsbO consists of an eight strand β-barrel, with a large loop between strands five and 6, which connects the OEC to the luminal surface (Ferreira, Iverson, Maghlaoui, Barber, & Iwata, 2004). Deletion studies of psbO in Synechocystis sp. have shown little effect to photoautotrophic growth and oxygen evolution, however a markedly higher susceptibility to photoinhibition (Mayes, Cook, Self, Zhang, & Barber, 1991). This suggests PsbO is not essential to PSII assembly or water-splitting, however provides protection of PSII from light-induced damage. | |
===Protein information=== | ===Protein information=== | ||
+ | |||
+ | mass: 27.96kDa | ||
+ | |||
+ | sequence:<br> | ||
+ | MAQKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFC | ||
+ | IEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERV | ||
+ | AFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPARADAEELLKENVKITKALKG | ||
+ | SAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK* | ||
+ | |||
+ | ===Part verification=== | ||
+ | |||
+ | Visualisation of '''psbO''' showing expected banding is shown in the following gel image, bottom row second set of lanes, with left lane part showing EcoRI digest, right lane showing EcoRI + PstI double digest. This part has been sequenced to confirm design with final biobrick. | ||
+ | |||
+ | <html><center><img src=https://static.igem.org/mediawiki/2015/6/6c/Image_6_results_1_gm_mq.jpg width=450px></center></html> | ||
===References=== | ===References=== | ||
+ | |||
+ | Ferreira, K. N., Iverson, T. M., Maghlaoui, K., Barber, J., & Iwata, S. (2004). Architecture of the Photosynthetic Oxygen-Evolving Center. Science, 303(5665), 1831-1838. doi:10.1126/science.1093087 | ||
+ | |||
+ | Mayes, S. R., Cook, K. M., Self, S. J., Zhang, Z., & Barber, J. (1991). Deletion of the gene encoding the Photosystem II 33 kDa protein from Synechocystis sp. PCC 6803 does not inactivate water-splitting but increases vulnerability to photoinhibition. Biochimica et Biophysica Acta (BBA) - Bioenergetics, 1060(1), 1-12. doi:http://dx.doi.org/10.1016/S0005-2728(05)80112-4 | ||
+ | |||
+ | Murata, N., & Miyao, M. (1985). Extrinsic membrane proteins in the photosynthetic oxygen-evolving complex. Trends in Biochemical Sciences, 10(3), 122-124. doi:http://dx.doi.org/10.1016/0968-0004(85)90272-5 |
Latest revision as of 01:49, 19 September 2015
psbO
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 754
- 1000COMPATIBLE WITH RFC[1000]
Overview
This biobrick contains one gene from the photosystem II complex of Chlamydomonas reinhardtii - psbO, with RBS.
This part was designed in conjunction with BBa_K1640022 and BBa_K1640012 and together they form operon 5 in our set of photosystem II operons:
![PSII diagram](https://static.igem.org/mediawiki/parts/thumb/a/a1/Macquarie_PS2_diagram.png/800px-Macquarie_PS2_diagram.png)
Biology & Literature
PsbO encodes psbO, a 33 kDa protein which acts to stabilise the cluster of four Mn2+ which forms the catalytic centre of the oxygen evolving complex (OEC) (Murata & Miyao, 1985). PsbO consists of an eight strand β-barrel, with a large loop between strands five and 6, which connects the OEC to the luminal surface (Ferreira, Iverson, Maghlaoui, Barber, & Iwata, 2004). Deletion studies of psbO in Synechocystis sp. have shown little effect to photoautotrophic growth and oxygen evolution, however a markedly higher susceptibility to photoinhibition (Mayes, Cook, Self, Zhang, & Barber, 1991). This suggests PsbO is not essential to PSII assembly or water-splitting, however provides protection of PSII from light-induced damage.
Protein information
mass: 27.96kDa
sequence:
MAQKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFC
IEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERV
AFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPARADAEELLKENVKITKALKG
SAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK*
Part verification
Visualisation of psbO showing expected banding is shown in the following gel image, bottom row second set of lanes, with left lane part showing EcoRI digest, right lane showing EcoRI + PstI double digest. This part has been sequenced to confirm design with final biobrick.
![](https://static.igem.org/mediawiki/2015/6/6c/Image_6_results_1_gm_mq.jpg)
References
Ferreira, K. N., Iverson, T. M., Maghlaoui, K., Barber, J., & Iwata, S. (2004). Architecture of the Photosynthetic Oxygen-Evolving Center. Science, 303(5665), 1831-1838. doi:10.1126/science.1093087
Mayes, S. R., Cook, K. M., Self, S. J., Zhang, Z., & Barber, J. (1991). Deletion of the gene encoding the Photosystem II 33 kDa protein from Synechocystis sp. PCC 6803 does not inactivate water-splitting but increases vulnerability to photoinhibition. Biochimica et Biophysica Acta (BBA) - Bioenergetics, 1060(1), 1-12. doi:http://dx.doi.org/10.1016/S0005-2728(05)80112-4
Murata, N., & Miyao, M. (1985). Extrinsic membrane proteins in the photosynthetic oxygen-evolving complex. Trends in Biochemical Sciences, 10(3), 122-124. doi:http://dx.doi.org/10.1016/0968-0004(85)90272-5