Difference between revisions of "Part:BBa K1640024"
(One intermediate revision by the same user not shown) | |||
Line 1: | Line 1: | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
<!-- --> | <!-- --> | ||
<span class='h3bb'>Sequence and Features</span> | <span class='h3bb'>Sequence and Features</span> | ||
Line 17: | Line 8: | ||
<partinfo>BBa_K1640024 parameters</partinfo> | <partinfo>BBa_K1640024 parameters</partinfo> | ||
<!-- --> | <!-- --> | ||
+ | |||
+ | ===Overview=== | ||
+ | |||
+ | This biobrick contains a gene from the photosystem II complex of ''Chlamydomonas reinhardtii'' - psbC, with RBS. | ||
+ | |||
+ | - psbC Encodes CP43, a subunit of the proximal antennae of Photosystem II. | ||
+ | |||
+ | This part was designed in conjunction with <html><a href="https://parts.igem.org/Part:BBa_K1640020">BBa_K1640020</a></html>, and together they form operon 1 in our set of photosystem II operons:<br><br> | ||
+ | |||
+ | <html><center><img src="https://static.igem.org/mediawiki/parts/thumb/a/a1/Macquarie_PS2_diagram.png/800px-Macquarie_PS2_diagram.png" width="450px" alt="PSII diagram"></center></html> | ||
+ | |||
+ | ===Biology & Literature=== | ||
+ | |||
+ | PsbC encodes CP43, a 44kDa protein which, along with CP47 (encoded by psbB), forms the proximal antennae which conducts energy from electron excitation from the external antennae to the Photosystem II (PSII) core reaction centre (Bricker & Frankel, 2002). CP43 binds 14 chlorophyll-a and 2-3 β-carotene molecules, through which excitation energy is transferred to the reaction centre for charge separation (van Grondelle, Dekker, Gillbro, & Sundstrom, 1994). | ||
+ | |||
+ | Deletion studies of psbC have demonstrated CP43 as non-essential for the assembly of the PSII core, with low levels of the core complex detected in Synechocystis sp. mutants (Vermaas, Ikeuchi, & Inoue, 1988). It is, however, an essential component for high yields of the PSII complex, with only a 10% yield found in psbC-less mutants (Vermaas et al., 1988). The CP43-less PSII complex also exhibits less efficiency in light-harvesting, with this protein estimated to contribute ~30% of the light-harvesting capacity of the PSII core complex (Vermaas et al., 1988). | ||
+ | |||
+ | ===Protein information=== | ||
+ | |||
+ | '''psbC''' | ||
+ | |||
+ | mass: 50.64kDa | ||
+ | |||
+ | sequence:<br> | ||
+ | METLFNGTLTVGGRDQETTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVSHFVPEKPMYEQ | ||
+ | GLILLPHIATLGYGVGPGGEIIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESYPFFGYVWKDKNK | ||
+ | MTNILGYHLIMLGLGAWLLVWKAMYFGGVYDTWAPGGGDVRVITNPTTNAAVIFGYLVKSPFGGDGWICSVD | ||
+ | NMEDIIGGHIWIGTLEILGGIWHIYTTPWPWARRAFVWSGEAYLSYSLGAIGVMGFIACCMSWFNNTAYPSE | ||
+ | FYGPTGPEASQSQAFTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP | ||
+ | NGLDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLACSHFCLGFFFFIGHLWH | ||
+ | AGRARAAAAGFEKGIDRFDEPVLSMRPLD* | ||
+ | |||
+ | |||
+ | ===Part verification=== | ||
+ | |||
+ | Visualisation of '''psbC''' showing expected banding is shown in the following gel image, top row first set of lanes, with left lane part showing EcoRI digest, right lane showing EcoRI + PstI double digest. This part has been sequenced to confirm design with final biobrick. | ||
+ | |||
+ | <html><center><img src=https://static.igem.org/mediawiki/2015/6/6c/Image_6_results_1_gm_mq.jpg width=450px></center></html> | ||
+ | |||
+ | |||
+ | |||
+ | ===References=== | ||
+ | |||
+ | Bricker, T., & Frankel, L. (2002). The structure and function of CP47 and CP43 in Photosystem II. Photosynthesis Research, 72(2), 131-146. doi:10.1023/A:1016128715865 | ||
+ | |||
+ | van Grondelle, R., Dekker, J. P., Gillbro, T., & Sundstrom, V. (1994). Energy transfer and trapping in photosynthesis. Biochimica et Biophysica Acta (BBA) - Bioenergetics, 1187(1), 1-65. doi:http://dx.doi.org/10.1016/0005-2728(94)90166-X | ||
+ | |||
+ | Vermaas, W. F. J., Ikeuchi, M., & Inoue, Y. (1988). Protein composition of the photosystem II core complex in genetically engineered mutants of the cyanobacterium Synechocystis sp. PCC 6803. In Govindjee (Ed.), Molecular Biology of Photosynthesis (pp. 389-405): Springer Netherlands. |
Latest revision as of 01:50, 19 September 2015
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25COMPATIBLE WITH RFC[25]
- 1000INCOMPATIBLE WITH RFC[1000]Illegal BsaI.rc site found at 1043
Overview
This biobrick contains a gene from the photosystem II complex of Chlamydomonas reinhardtii - psbC, with RBS.
- psbC Encodes CP43, a subunit of the proximal antennae of Photosystem II.
This part was designed in conjunction with BBa_K1640020, and together they form operon 1 in our set of photosystem II operons:
Biology & Literature
PsbC encodes CP43, a 44kDa protein which, along with CP47 (encoded by psbB), forms the proximal antennae which conducts energy from electron excitation from the external antennae to the Photosystem II (PSII) core reaction centre (Bricker & Frankel, 2002). CP43 binds 14 chlorophyll-a and 2-3 β-carotene molecules, through which excitation energy is transferred to the reaction centre for charge separation (van Grondelle, Dekker, Gillbro, & Sundstrom, 1994).
Deletion studies of psbC have demonstrated CP43 as non-essential for the assembly of the PSII core, with low levels of the core complex detected in Synechocystis sp. mutants (Vermaas, Ikeuchi, & Inoue, 1988). It is, however, an essential component for high yields of the PSII complex, with only a 10% yield found in psbC-less mutants (Vermaas et al., 1988). The CP43-less PSII complex also exhibits less efficiency in light-harvesting, with this protein estimated to contribute ~30% of the light-harvesting capacity of the PSII core complex (Vermaas et al., 1988).
Protein information
psbC
mass: 50.64kDa
sequence:
METLFNGTLTVGGRDQETTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVSHFVPEKPMYEQ
GLILLPHIATLGYGVGPGGEIIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESYPFFGYVWKDKNK
MTNILGYHLIMLGLGAWLLVWKAMYFGGVYDTWAPGGGDVRVITNPTTNAAVIFGYLVKSPFGGDGWICSVD
NMEDIIGGHIWIGTLEILGGIWHIYTTPWPWARRAFVWSGEAYLSYSLGAIGVMGFIACCMSWFNNTAYPSE
FYGPTGPEASQSQAFTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP
NGLDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLACSHFCLGFFFFIGHLWH
AGRARAAAAGFEKGIDRFDEPVLSMRPLD*
Part verification
Visualisation of psbC showing expected banding is shown in the following gel image, top row first set of lanes, with left lane part showing EcoRI digest, right lane showing EcoRI + PstI double digest. This part has been sequenced to confirm design with final biobrick.
References
Bricker, T., & Frankel, L. (2002). The structure and function of CP47 and CP43 in Photosystem II. Photosynthesis Research, 72(2), 131-146. doi:10.1023/A:1016128715865
van Grondelle, R., Dekker, J. P., Gillbro, T., & Sundstrom, V. (1994). Energy transfer and trapping in photosynthesis. Biochimica et Biophysica Acta (BBA) - Bioenergetics, 1187(1), 1-65. doi:http://dx.doi.org/10.1016/0005-2728(94)90166-X
Vermaas, W. F. J., Ikeuchi, M., & Inoue, Y. (1988). Protein composition of the photosystem II core complex in genetically engineered mutants of the cyanobacterium Synechocystis sp. PCC 6803. In Govindjee (Ed.), Molecular Biology of Photosynthesis (pp. 389-405): Springer Netherlands.