Difference between revisions of "Part:BBa J58105"

 
(3 intermediate revisions by one other user not shown)
Line 2: Line 2:
 
<partinfo>BBa_J58105 short</partinfo>
 
<partinfo>BBa_J58105 short</partinfo>
  
 +
[[Image:vanbp.png|thumb|300px|Part of the active site of the computationally designed vanillin-binding protein. Dashed lines denote h-bonds. Only the residues making h-bonds with the vanillin molecule are shown on top.]]
 
This part corresponds to the coding sequence of a computationally engineered protein designed by Pablo Tortosa and Alfonso Jaramillo at the [http://www.enseignement.polytechnique.fr/profs/biochimie/Alfonso.Jaramillo/ Synthetic Biology group at the Ecole Polytechnique (France)]. This protein is based on a ribose-binding protein template and has been designed to stabilize its closed conformation after binding a vanillin molecule. The closed conformation is able to bind a Trg protein. This part can be used to engineer a sensor genetic device if used with the part <partinfo>J58104</partinfo> (which implements a synthetic two-component signal transduction pathway based on a Trg-EnvZ fusion protein). This device would use phosphorylated OmpR as output.  
 
This part corresponds to the coding sequence of a computationally engineered protein designed by Pablo Tortosa and Alfonso Jaramillo at the [http://www.enseignement.polytechnique.fr/profs/biochimie/Alfonso.Jaramillo/ Synthetic Biology group at the Ecole Polytechnique (France)]. This protein is based on a ribose-binding protein template and has been designed to stabilize its closed conformation after binding a vanillin molecule. The closed conformation is able to bind a Trg protein. This part can be used to engineer a sensor genetic device if used with the part <partinfo>J58104</partinfo> (which implements a synthetic two-component signal transduction pathway based on a Trg-EnvZ fusion protein). This device would use phosphorylated OmpR as output.  
 
[[Image:vanbp.png|thumb|300px|Part of the active site of the computationally designed vanillin-binding protein. Dashed lines denote h-bonds. Only the residues making h-bonds with the vanillin molecule are shown on top.]]
 
  
 
This receptor protein has been designed computationally using a ribose binding protein as a scaffold and finding the necessary mutations to change its ligand affinity towards a vanillin molecule making E. Coli tasting flavors.  
 
This receptor protein has been designed computationally using a ribose binding protein as a scaffold and finding the necessary mutations to change its ligand affinity towards a vanillin molecule making E. Coli tasting flavors.  
  
----
 
 
 
'''By Valencia iGEM 2006'''
 
 
''A. Aparici (2), MC. Aroca (2), J. Carrera (1), C. Edo (1,2), G. Fuertes (2), D. Jimenez (2), C. Mata (2), JV. Medrano (2), A. Montagud (2), C. Navarrete (2), E. Navarro (1), G. Rodrigo (1), M. Baguena (1), P. Tortosa (3), P. Fernandez-de-Cordoba (1), A. Ferrando (2), J. Salgado (2), J. Urchueguia (1), A. Jaramillo (3).''
 
 
''1 Universidad Politecnica de Valencia, Spain''
 
 
''2 Universitat de Valencia, Spain''
 
 
''3 Ecole Polytechnique, France''
 
  
 
===Usage and Biology===
 
===Usage and Biology===
Line 31: Line 18:
  
 
'''References'''
 
'''References'''
[1] [http://www.intertech.upv.es/wiki/index.php?title=Valencia_iGEM wiki Valencia team]
+
 
 +
[1] [http://www.igem.upv.es/igem06 wiki Valencia team]
  
 
[2] A. Jaramillo, L. Wernisch, S. Hery and S.J. Wodak. Folding free energy function selects native-like protein sequences in the core but not on the surface. Proc. Natl. Acad. Sci. 99 (2002), 13554-13559.
 
[2] A. Jaramillo, L. Wernisch, S. Hery and S.J. Wodak. Folding free energy function selects native-like protein sequences in the core but not on the surface. Proc. Natl. Acad. Sci. 99 (2002), 13554-13559.
Line 37: Line 25:
 
[3] L.L. Looger, M.A. Dwyer, J. Smith, H.W. Hellinga. Computational design of receptor and sensor proteins with novel functions. Nature, 423, 185-190 (2003).  
 
[3] L.L. Looger, M.A. Dwyer, J. Smith, H.W. Hellinga. Computational design of receptor and sensor proteins with novel functions. Nature, 423, 185-190 (2003).  
  
[4]Baumgartner J. W., Changhoon Kim, Brissette R. E., Inouye M., Chankyu Park, Hazelbauer G. L.,Journal of bacteriology 1994, vol. 176, no4, pp. 1157-1163
 
 
[5] J.K. Joung, D.M. Koepp, and A. Hochschild. Synergistic activation of transcription by bacteriophage lambda cI protein and E. coli cAMP receptor protein. Science, 265, 1863-1866 (1994).
 
  
 
<span class='h3bb'>Sequence and Features</span>
 
<span class='h3bb'>Sequence and Features</span>
Line 88: Line 73:
 
<partinfo>BBa_J58105 parameters</partinfo>
 
<partinfo>BBa_J58105 parameters</partinfo>
 
<!-- -->
 
<!-- -->
 +
----
 +
 +
 +
'''By Valencia iGEM 2006'''
 +
 +
''A. Aparici (2), MC. Aroca (2), J. Carrera (1), C. Edo (1,2), G. Fuertes (2), D. Jimenez (2), C. Mata (2), JV. Medrano (2), A. Montagud (2), C. Navarrete (2), E. Navarro (1), G. Rodrigo (1), M. Baguena (1), P. Tortosa (3), P. Fernandez-de-Cordoba (1), A. Ferrando (2), J. Salgado (2), J. Urchueguia (1), A. Jaramillo (3).''
 +
 +
''1 Universidad Politecnica de Valencia, Spain''
 +
 +
''2 Universitat de Valencia, Spain''
 +
 +
''3 Ecole Polytechnique, France''

Latest revision as of 16:36, 22 August 2007

Synthetic periplasmic binding protein that docks a vanillin molecule

Part of the active site of the computationally designed vanillin-binding protein. Dashed lines denote h-bonds. Only the residues making h-bonds with the vanillin molecule are shown on top.

This part corresponds to the coding sequence of a computationally engineered protein designed by Pablo Tortosa and Alfonso Jaramillo at the [http://www.enseignement.polytechnique.fr/profs/biochimie/Alfonso.Jaramillo/ Synthetic Biology group at the Ecole Polytechnique (France)]. This protein is based on a ribose-binding protein template and has been designed to stabilize its closed conformation after binding a vanillin molecule. The closed conformation is able to bind a Trg protein. This part can be used to engineer a sensor genetic device if used with the part BBa_J58104 (which implements a synthetic two-component signal transduction pathway based on a Trg-EnvZ fusion protein). This device would use phosphorylated OmpR as output.

This receptor protein has been designed computationally using a ribose binding protein as a scaffold and finding the necessary mutations to change its ligand affinity towards a vanillin molecule making E. Coli tasting flavors.


Usage and Biology

We can use this part to construct a sensor device. It requires using E. coli as cellular chassis (with a deficient EnvZ strain such as BBa_V1012) and the synthetic two-component signal transduction pathway implemented in part BBa_J58104. The device would then produce OmpR-P after sensing a vanillin molecule in the periplasm.

The receptor protein has been designed computationally using a ribose binding protein as a scaffold and finding the necessary mutations to change its ligand affinity towards a vanillin molecule making E. Coli tasting flavors. The computational methodology is general and can be used to sense other molecules.

When the PBP-vanillin complex binds the Trg segment of our signal transduction part BBa_J58104, an allosteric motion is propagated to the cytoplasmic EnvZ kinase domain of our chimeric protein resulting in autophosphorylation and phosphate transfer to OmpR transcription factor (OmpR-P), which is then able to induce transcription of the pOmpR promoter.

Our sensor device has been inspired on Hellinga’s work [3] sensing TNT and other molecules using a mutated periplasmic binding protein (PBP) [3].

References

[1] [http://www.igem.upv.es/igem06 wiki Valencia team]

[2] A. Jaramillo, L. Wernisch, S. Hery and S.J. Wodak. Folding free energy function selects native-like protein sequences in the core but not on the surface. Proc. Natl. Acad. Sci. 99 (2002), 13554-13559.

[3] L.L. Looger, M.A. Dwyer, J. Smith, H.W. Hellinga. Computational design of receptor and sensor proteins with novel functions. Nature, 423, 185-190 (2003).


Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    COMPATIBLE WITH RFC[25]
  • 1000
    COMPATIBLE WITH RFC[1000]

Designed sequence (14 mutations, in yellow):

mnmkklatlvsavalsatvsanamaKDTIALVVETLNKPDNVSLKDGAQK

EADKLGYNLVVLDSQNNPAKELANVQDLTVRGTKILLIVPTDSDAVGNAV

KMANQANIPVITLKRQATKGEVVSHIAADNVLGGKIAGDYIAKKAGEGAK

VIELQGKAGTSAARELGEGFQQAVAAHKFNVLASQPADEDRIKGLNVMQN

LLTAHPDVQAVFAQQDEMALGALRALQTAGKSDVMVVGDVGTPDGEKAVN

DGKLAATIAELPDQIGAKGVETADKVLKGEKVQAKYPVDLKLVVKQ




By Valencia iGEM 2006

A. Aparici (2), MC. Aroca (2), J. Carrera (1), C. Edo (1,2), G. Fuertes (2), D. Jimenez (2), C. Mata (2), JV. Medrano (2), A. Montagud (2), C. Navarrete (2), E. Navarro (1), G. Rodrigo (1), M. Baguena (1), P. Tortosa (3), P. Fernandez-de-Cordoba (1), A. Ferrando (2), J. Salgado (2), J. Urchueguia (1), A. Jaramillo (3).

1 Universidad Politecnica de Valencia, Spain

2 Universitat de Valencia, Spain

3 Ecole Polytechnique, France