Difference between revisions of "Part:BBa K4726002:Design"
(→Source) |
(→References) |
||
Line 30: | Line 30: | ||
===References=== | ===References=== | ||
+ | [1] Liu QP, Yuan H, Bennett EP, Levery SB, Nudelman E, Spence J, Pietz G, Saunders K, White T, Olsson ML, Henrissat B, Sulzenbacher G, Clausen H. Identification of a GH110 subfamily of alpha 1,3-galactosidases: novel enzymes for removal of the alpha 3Gal xenotransplantation antigen. J Biol Chem. 2008 Mar 28;283(13):8545-54. doi: 10.1074/jbc.M709020200. Epub 2008 Jan 28. PMID: 18227066; PMCID: PMC2417185. |
Revision as of 00:45, 10 October 2023
α-galactosidase GH110b_Bacteroides fragilis
- 10INCOMPATIBLE WITH RFC[10]Illegal EcoRI site found at 1213
Illegal EcoRI site found at 1714 - 12INCOMPATIBLE WITH RFC[12]Illegal EcoRI site found at 1213
Illegal EcoRI site found at 1714 - 21INCOMPATIBLE WITH RFC[21]Illegal EcoRI site found at 1213
Illegal EcoRI site found at 1714 - 23INCOMPATIBLE WITH RFC[23]Illegal EcoRI site found at 1213
Illegal EcoRI site found at 1714 - 25INCOMPATIBLE WITH RFC[25]Illegal EcoRI site found at 1213
Illegal EcoRI site found at 1714 - 1000COMPATIBLE WITH RFC[1000]
Design Notes
In order to clone this genetic construct onto our expression vector (pET-3a) we added NdeI site in 5' and BamHI site in 3' of the gene. We added TATATA sequences before the NdeI site and after the BamHI site to assist with the restriction digestion (those sites are not on the part sequence). The part sequence included a 6x His-tag on the C-terminus of the protein.
Source
This gene originates from Bacteroides fragilis, a bacterium from the human gut microbiota. It encodes a N-acetyl-α-D-galactosamine deacetylase.
The amino sequence is:
MKTILLFALSLLLSLSVSDVCAQERVYDISQFGLKANSKKNASPVVRKAI AKIKAECRDGEKVILRFPAGRYNFHEAGSTVREYYISNHDQDNPKKVGIA LEDMKNLTIDGQGSEFVFYGRMIPVSLLRSENCVLKNFSIDFEQPHIAQV QVVENDPEKGITFEPAPWVDYRISKDSVFEGLGEGWVMRYSWGIAFDGKT KHVVYNTSDIGCPTKGAFEVAPRRICSPKWKDARLVPGTVVAMRGWGRPT PGIFMSHDVNTSLLDVKVHYAEGMGLLAQLCEDITLDGFGVCLKGDNDPR YFTTQADATHFSGCKGKIVSKNGLYEGMMDDAINVHGTYLKVIKRVDDHT LIGRYMHDQSWGFEWGRPGDDVQFVRSETMELIGKQNQITAIRPYDKGEI RGAREFSITFKEAIDPAINEKSGFGIENLTWTPEVLFAGNTIRNNRARGT LFSTPKKTVVEDNLFDHTSGTAILLCGDCNGWFETGACRDVTIRRNRFIN ALTNMFQFTNAVISIYPEIPNLKDQQKYFHGGKDGGIVIEDNEFDTFDAP ILYAKSVDGLIFRNNVIKTNTEFKPFHWNKDRFLLERVTNVKISEHHHHH H
References
[1] Liu QP, Yuan H, Bennett EP, Levery SB, Nudelman E, Spence J, Pietz G, Saunders K, White T, Olsson ML, Henrissat B, Sulzenbacher G, Clausen H. Identification of a GH110 subfamily of alpha 1,3-galactosidases: novel enzymes for removal of the alpha 3Gal xenotransplantation antigen. J Biol Chem. 2008 Mar 28;283(13):8545-54. doi: 10.1074/jbc.M709020200. Epub 2008 Jan 28. PMID: 18227066; PMCID: PMC2417185.