Difference between revisions of "Part:BBa K3889023"

Revision as of 05:42, 18 October 2021 (view source) AshWinShaRma (Talk | contribs) ← Older edit		Revision as of 05:58, 18 October 2021 (view source) AshWinShaRma (Talk | contribs) Newer edit →
Line 22:		Line 22:
	</body>		</body>
	</html>		</html>
−		+	Fig source: Geneious version 2021.2 created by Biomatters. Available from https://www.geneious.com

---

Revision as of 05:58, 18 October 2021

Human Ovastacin protease phosphomimic_B

Since ovastacin (BBa_K3889024) has a eukaryotic origin, this protein undergoes several Post Translational Modifications (PTMs) including the addition of disulphide bonds and phosphorylation at serine and tyrosine residues. However, the recombinant protein if produced in a prokaryotic organism will lack the necessary machinery to carry out PTMs. Hence, a phosphomimetic variant(s) of ovastacin was made by changing or mutating the serine to aspartic acid and tyrosine to glutamic acid residues at S99, S156, S244 and Y279 (amino acid numbered with reference to pro-ovastacin) respectively.

Protein Sequence

RLLSAASNKWPMGGDGVVEVPFLLSSKYDEPSRQVILEALAEFERSTCIRFVTYQDQRDFISIIPMYGCFSDVGRSGGMQVVSLAPTCLQKGRGIVLHELMHVLGFWHE HTRADRDRYIRVNWNEILPGFEINFIKSRSSNMLTPYDYSSVMHYGRLAFDRRGLPTITPLWAPSVHIGQRWNLSASDITRVLKLYGCS

where red denotes the active site [1]

Fig source: Geneious version 2021.2 created by Biomatters. Available from https://www.geneious.com

Sequence and Features

References

1. Anna D. Burkart, Bo Xiong, Boris Baibakov, Maria Jiménez-Movilla, Jurrien Dean; Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy. J Cell Biol 2 April 2012; 197 (1): 37–44. doi: https://doi.org/10.1083/jcb.201112094