Difference between revisions of "Part:BBa K1998001"
SWinchester (Talk | contribs) |
|||
(One intermediate revision by one other user not shown) | |||
Line 14: | Line 14: | ||
===Overview=== | ===Overview=== | ||
− | This composite part | + | This composite part consists of the genes <i>yCF54</i> and <i>chlM</i>. They come from the chlorophyll biosynthetic pathway of <i>Chlamydomonas reinhardtii</i>. The genes encode the enzymes Mg-protoporphyrin IX monomethyl ester (oxidative) cyclase (<i>yCF54</i>) and Magnesium-protoporphyrin O-methyltransferase (<i>chlM</i>). When combined with the Mg-chelatase plasmid BBa_K1998000, it can convert protoporphyrin IX to protochlorophyllide. |
<br><br> | <br><br> | ||
<html><center><img src="https://static.igem.org/mediawiki/2016/0/0f/T--Macquarie_Australia--ChlorophyllBiosynthesisDiagram.png" alt="ChlorophyllBiosynthesisDiagram" height="50%"width="75%"></center></html> | <html><center><img src="https://static.igem.org/mediawiki/2016/0/0f/T--Macquarie_Australia--ChlorophyllBiosynthesisDiagram.png" alt="ChlorophyllBiosynthesisDiagram" height="50%"width="75%"></center></html> | ||
Line 22: | Line 22: | ||
The second gene in this part is <i>chlM</i>. <i>chlM</i> encodes for a magnesium protoporhyrin IX methytransferase. <i>chlM's</i> role in the pathway is to methylate Mg-protoporphyrin IX which then aids the catalysis of Mg-cheltase [2]. This then facilitates the formation of the final protochlorophyllide. Involved in the second step of the pathway, the <i>chlM</i> gene is involved in the transfer of a methyl group onto one of the rings of magnesium protoporphyrin which forms the magnesium prootoporhyrin IX monomethylester [3, 4]. | The second gene in this part is <i>chlM</i>. <i>chlM</i> encodes for a magnesium protoporhyrin IX methytransferase. <i>chlM's</i> role in the pathway is to methylate Mg-protoporphyrin IX which then aids the catalysis of Mg-cheltase [2]. This then facilitates the formation of the final protochlorophyllide. Involved in the second step of the pathway, the <i>chlM</i> gene is involved in the transfer of a methyl group onto one of the rings of magnesium protoporphyrin which forms the magnesium prootoporhyrin IX monomethylester [3, 4]. | ||
+ | |||
+ | ===Part Verification=== | ||
+ | <html><center><img src="https://static.igem.org/mediawiki/2016/b/bd/T--Macquarie_Australia--Importantresults.jpg" " width="50%" height="35%"></center> </html> | ||
+ | <b>Fig 1.</b>Gel electrophoresis (1% agarose) provides evidence of successful assembly of <i>pLac-ycf54-chlM</i> (1.5 kbp) plasmid (Lane 3). The plasmid was assembled via 3A assembly and double digested to reveal the biobrick backbone (2000 bp) and the correct insert size.<br> | ||
+ | <br> | ||
+ | <br> | ||
+ | <html><center> <img src="https://static.igem.org/mediawiki/2016/f/f2/T--Macquarie_Australia--CBPRes2.png" " width="35%" height="70%"></center> </html> | ||
+ | <b>Fig 2.</b>PCR confirmation of the <i>pLac-ycf54-chlM</i> plasmid. Forward and reverse <i>chlM</i> primers were used to confirm the presence of the <i>chlM</i> gene. The presence of <i>yCF54</i> gene was also confirmed using the <i>pLac</i> forward primer with the reverse <i>yCF54</i> primer. This also confirmed the presence of the lac promoter followed by <i>yCF54</i> (700 bp in total).<br> | ||
===Protein information=== | ===Protein information=== |
Latest revision as of 02:32, 21 October 2016
YCF54 - ChlM
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21INCOMPATIBLE WITH RFC[21]Illegal BglII site found at 912
Illegal BamHI site found at 316 - 23COMPATIBLE WITH RFC[23]
- 25COMPATIBLE WITH RFC[25]
- 1000INCOMPATIBLE WITH RFC[1000]Illegal BsaI site found at 478
Overview
This composite part consists of the genes yCF54 and chlM. They come from the chlorophyll biosynthetic pathway of Chlamydomonas reinhardtii. The genes encode the enzymes Mg-protoporphyrin IX monomethyl ester (oxidative) cyclase (yCF54) and Magnesium-protoporphyrin O-methyltransferase (chlM). When combined with the Mg-chelatase plasmid BBa_K1998000, it can convert protoporphyrin IX to protochlorophyllide.
Biology & Literature
These two genes within this part are used within an operon in the biosynthesis pathway. cF54 works with the cTH1 gene and Plastocyanin within the oxidative cyclase pathway. It's interaction with other genes results in the catalysis of the biosynthesis pathway from Mg-protoporphyrin IX to Protochlorophyllide [1]. Deletion studies have detected the importance of yCF54 in maintaining levels of Mg-protoporphyrin IX methyl ester indicating that the yCF54 gene is critical to both the assembly and function of the cyclase complex [1].
The second gene in this part is chlM. chlM encodes for a magnesium protoporhyrin IX methytransferase. chlM's role in the pathway is to methylate Mg-protoporphyrin IX which then aids the catalysis of Mg-cheltase [2]. This then facilitates the formation of the final protochlorophyllide. Involved in the second step of the pathway, the chlM gene is involved in the transfer of a methyl group onto one of the rings of magnesium protoporphyrin which forms the magnesium prootoporhyrin IX monomethylester [3, 4].
Part Verification
Protein information
yCF54
mass: 17.08kDa
sequence: MAPAAASADKATAAEYYALVCNAEWFFMDPQNESVAEQLREKVRFFKEQN KERDFFIVPNPKWLDAKFPEQAKQVKRPCVALVSTDKMWITFMKLRLDRV LKIDLKSMPASEVLAAGEALPDFKPDGKWTAPYARYTPGWWNVFLPNH
chlM
mass: 30.45kDa
sequence: MASEIAQTADVGSLTFAVGGVGAVVGLGALLVATDHQKRRSEQMKSFDGD EKEAVKDYFNTAGFERWRKIYGETDEVNKVQLDIRTGHAQTVDKVLRWVD EEGSVQGITVADCGCGTGSLAIQLALRGAAVSASDISAAMASEAEQRYQQ AVAAGQGKAPKVAPKFEALDLESVKGKYDTVTCLDVMIHYPQDKVDAMIT HLAGLSDRRLIISFAPKTLSYSILKRIGELFPGPSKATRAYLHREEDVEAALK
RAGFKVTKREMTATSFYFSRLLEAIRE
References
[1] Hollingshead S, Kopečná J, Jackson PJ, Canniffe DP, Davison PA, Dickman MJ, Sobotka R, Hunter CN. Conserved chloroplast open-reading frame ycf54 is required for activity of the magnesium protoporphyrin monomethylester oxidative cyclase in Synechocystis PCC 6803. Journal of Biological Chemistry. 2012 Aug 10;287(33):27823-33.
[2] Alawady A, Reski R, Yaronskaya E, Grimm B. Cloning and expression of the tobacco CHLM sequence encoding Mg protoporphyrin IX methyltransferase and its interaction with Mg chelatase. Plant molecular biology. 2005 Mar 1;57(5):679-91.
[3] Shepherd M, McLean S, Hunter CN. Kinetic basis for linking the first two enzymes of chlorophyll biosynthesis. FEBS Journal. 2005 Sep 1;272(17):4532-9.
[4] Meinecke L, Alawady A, Schroda M, Willows R, Kobayashi MC, Niyogi KK, Grimm B, Beck CF. Chlorophyll-deficient mutants of Chlamydomonas reinhardtii that accumulate magnesium protoporphyrin IX. Plant molecular biology. 2010 Apr 1;72(6):643-58.