Difference between revisions of "Part:BBa K1998009"
SWinchester (Talk | contribs) (→References) |
SWinchester (Talk | contribs) (→References) |
||
Line 37: | Line 37: | ||
===References=== | ===References=== | ||
[1] Nair RR, Emmons MF, Cress AE, Argilagos RF, Lam K, Kerr WT, Wang HG, Dalton WS, Hazlehurst LA. HYD1-induced increase in reactive oxygen species leads to autophagy and necrotic cell death in multiple myeloma cells. Molecular cancer therapeutics. 2009 Aug 1;8(8):2441-51. | [1] Nair RR, Emmons MF, Cress AE, Argilagos RF, Lam K, Kerr WT, Wang HG, Dalton WS, Hazlehurst LA. HYD1-induced increase in reactive oxygen species leads to autophagy and necrotic cell death in multiple myeloma cells. Molecular cancer therapeutics. 2009 Aug 1;8(8):2441-51. | ||
− | <br> | + | <br><br> |
[2] Redwood MD, Mikheenko IP, Sargent F, Macaskie LE. Dissecting the roles of Escherichia coli hydrogenases in biohydrogen production. FEMS microbiology letters. 2008 Jan 1;278(1):48-55. | [2] Redwood MD, Mikheenko IP, Sargent F, Macaskie LE. Dissecting the roles of Escherichia coli hydrogenases in biohydrogen production. FEMS microbiology letters. 2008 Jan 1;278(1):48-55. | ||
− | <br> | + | <br><br> |
[3] Bisaillon A, Turcot J, Hallenbeck PC. The effect of nutrient limitation on hydrogen production by batch cultures of Escherichia coli. International Journal of Hydrogen Energy. 2006 Sep 30;31(11):1504-8. | [3] Bisaillon A, Turcot J, Hallenbeck PC. The effect of nutrient limitation on hydrogen production by batch cultures of Escherichia coli. International Journal of Hydrogen Energy. 2006 Sep 30;31(11):1504-8. | ||
− | <br> | + | <br><br> |
[4] Trchounian K, Trchounian A. Hydrogenase 2 is most and hydrogenase 1 is less responsible for H 2 production by Escherichia coli under glycerol fermentation at neutral and slightly alkaline pH. international journal of hydrogen energy. 2009 Nov 30;34(21):8839-45. | [4] Trchounian K, Trchounian A. Hydrogenase 2 is most and hydrogenase 1 is less responsible for H 2 production by Escherichia coli under glycerol fermentation at neutral and slightly alkaline pH. international journal of hydrogen energy. 2009 Nov 30;34(21):8839-45. | ||
− |
Revision as of 00:31, 21 October 2016
Hyd1
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12INCOMPATIBLE WITH RFC[12]Unknown
- 21INCOMPATIBLE WITH RFC[21]Unknown
- 23INCOMPATIBLE WITH RFC[23]Unknown
- 25COMPATIBLE WITH RFC[25]
- 1000COMPATIBLE WITH RFC[1000]
Overview
HYD1 is an oxygen-tolerant hydrogenase; it is a respiratory enzyme that catalyses hydrogen oxidation. It has been suggested that it functions at more positive redox potentials, which are located at the aerobic-anaerobic interface. It forms one of the enzymes found in our hydrogenase pathway of our system.
Biology & Literature
Hydrogenase 1 (Hyd1) is a gene which codes for a peptide containing 10 D-amino acids which has been known to induce cell autophagy resulting from an increase in reactive oxygen species and ATP depletion of the cell [1]. Hyd1 has also been known to help treat prostate cancer by preventing the adhesion of carcinomas to the epithelium lining of the digestive tract [1].
More specifically Hyd1 catalyses the oxidation of hydrogen in the anaerobic respiration of E.coli [2] this done by working in parallel with Hyd 2 before fermentation is undertaken by Hyd3 [2, 3]. Hyd1 is a membrane bound hydrogenase that facilitates the uptake of oxidated hydrogen gas [3]. The hya operon encodes the Hydrogenase peptide which is initiated under anaerobic conditions as well as acidic pH levels which signals that H+ must be facilitated to move from ICF to ECF and viceverser to maintain pH levels in E.coli [3, 4].
Protein information
Hyd1
Mass: 53.13 kDa
Sequence:
MSALVLKPCAAVSIRGSSCRARQVAPRAPLAASTVRVALATLEAPARRLGNVACAAAAPAAEAPLSHVQQALAELAKPKDDPTRKHVCVQVAPAVRVAIAETLGLAPGATT
PKQLAEGLRRLGFDEVFDTLFGADLTIMEEGSELLHRLTEHLEAHPHSDEPLPMFTSCCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMV
SIMPCTRKQSEADRDWFCVDADPTLRQLDHVITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKET
NITMVPAPGSKFEELLKHRAAARAEAAAHGTPGPLAWDGGAGFTSEDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKR
QAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGVEEKDEKK
References
[1] Nair RR, Emmons MF, Cress AE, Argilagos RF, Lam K, Kerr WT, Wang HG, Dalton WS, Hazlehurst LA. HYD1-induced increase in reactive oxygen species leads to autophagy and necrotic cell death in multiple myeloma cells. Molecular cancer therapeutics. 2009 Aug 1;8(8):2441-51.
[2] Redwood MD, Mikheenko IP, Sargent F, Macaskie LE. Dissecting the roles of Escherichia coli hydrogenases in biohydrogen production. FEMS microbiology letters. 2008 Jan 1;278(1):48-55.
[3] Bisaillon A, Turcot J, Hallenbeck PC. The effect of nutrient limitation on hydrogen production by batch cultures of Escherichia coli. International Journal of Hydrogen Energy. 2006 Sep 30;31(11):1504-8.
[4] Trchounian K, Trchounian A. Hydrogenase 2 is most and hydrogenase 1 is less responsible for H 2 production by Escherichia coli under glycerol fermentation at neutral and slightly alkaline pH. international journal of hydrogen energy. 2009 Nov 30;34(21):8839-45.