Difference between revisions of "Part:BBa K1998005"

Line 14: Line 14:
  
 
===Overview===
 
===Overview===
This part is made up of psbC and psbA. The psbC gene that comprises this part codes a subunit that makes up the Photosystem II protein P680. The P680 complex is photosystem II primary electron donor. The psbA gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core.
+
This part is made up of <i>psbC</i> and <i>psbA</i>. The <i>psbC</i> gene that comprises this part codes a subunit that makes up the Photosystem II protein P680. The P680 complex is photosystem II primary electron donor. The <i>psbA</i> gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction centre core.
 
<br><br>
 
<br><br>
 
<html><center><img src= "https://static.igem.org/mediawiki/2016/a/aa/T--Macquarie_Australia--PhotosystemIISynthesis.png" alt="PhotosystemIISynthesis" height="50%"width="75%"></center></html>
 
<html><center><img src= "https://static.igem.org/mediawiki/2016/a/aa/T--Macquarie_Australia--PhotosystemIISynthesis.png" alt="PhotosystemIISynthesis" height="50%"width="75%"></center></html>
  
 
===Biology & Literature===
 
===Biology & Literature===
The first gene, psbC encodes CP43 protein which connects with the CP47 encoded by psbB. Along with the CP47, psbC form a proximal antennae. This conducts electron excitation from the external antennae to the PSII core reaction centre [1]. Due to results from deletion studies, the role of the CP43/psbC protein has been described as non-essential for the PSII core assembly [2]. Other studies have found it however helps with the accumulation of the PSII complexes and light harvesting efficiency [2].
+
The first gene, <i>psbC</i> encodes CP43 protein which connects with the CP47 encoded by <i>psbB</i>. Along with the CP47, <i>psbC</i> form a proximal antennae. This conducts electron excitation from the external antennae to the PSII core reaction centre [1]. Due to results from deletion studies, the role of the <i>CP43/psbC</i> protein has been described as non-essential for the PSII core assembly [2]. Other studies have found it however helps with the accumulation of the PSII complexes and light harvesting efficiency [2].
 
<br><br>
 
<br><br>
The second gene in this part, psbA, encodes the D1 subunit of PSII. Along with the psbD which encodes the D2 subunit, it forms a heterodimer. This forms the PSII reaction centre [3] which is responsible for electron transfer from chlorophyll P680 to quinones QA and QB. It is also vital to the assembly of the oxygen evolving complex and QB within PSII [4].  
+
The second gene in this part, <i>psbA</i>, encodes the D1 subunit of PSII. Along with the <i>psbD</i> which encodes the D2 subunit, it forms a heterodimer. This forms the PSII reaction centre [3] which is responsible for electron transfer from chlorophyll P680 to quinones QA and QB. It is also vital to the assembly of the oxygen evolving complex and QB within PSII [4].  
  
 
===Protein information===
 
===Protein information===
psbC
+
<i>psbC</i>
 
<br>
 
<br>
 
mass: 50.64kDa
 
mass: 50.64kDa
Line 37: Line 37:
 
<br>
 
<br>
  
psbA<br>
+
<i>psbA</i><br>
 
mass: 30kDa<br>
 
mass: 30kDa<br>
 
sequence:<br>
 
sequence:<br>
Line 52: Line 52:
 
[2] Vermaas WF, Ikeuchi M, Inoue Y. Protein composition of the photosystem II core complex in genetically engineered mutants of the cyanobacterium Synechocystis sp. PCC 6803. InMolecular Biology of Photosynthesis 1988 (pp. 389-405). Springer Netherlands.
 
[2] Vermaas WF, Ikeuchi M, Inoue Y. Protein composition of the photosystem II core complex in genetically engineered mutants of the cyanobacterium Synechocystis sp. PCC 6803. InMolecular Biology of Photosynthesis 1988 (pp. 389-405). Springer Netherlands.
 
<br><br>
 
<br><br>
[3] Marder JB, Chapman DJ, Telfer A, Nixon PJ, Barber J. Identification of psbA and psbD gene products, D1 and D2, as reaction centre proteins of photosystem 2. Plant molecular biology. 1987 Jul 1;9(4):325-33.
+
[3] Marder JB, Chapman DJ, Telfer A, Nixon PJ, Barber J. Identification of <i>psbA</i> and <i>psbD</i> gene products, <i>D1</i> and <i>D2</i>, as reaction centre proteins of photosystem 2. Plant molecular biology. 1987 Jul 1;9(4):325-33.
 
<br><br>
 
<br><br>
 
[4] Ferreira KN, Iverson TM, Maghlaoui K, Barber J, Iwata S. Architecture of the photosynthetic oxygen-evolving center. Science. 2004 Mar 19;303(5665):1831-8.
 
[4] Ferreira KN, Iverson TM, Maghlaoui K, Barber J, Iwata S. Architecture of the photosynthetic oxygen-evolving center. Science. 2004 Mar 19;303(5665):1831-8.

Revision as of 18:26, 19 October 2016


psbCA

Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    COMPATIBLE WITH RFC[25]
  • 1000
    INCOMPATIBLE WITH RFC[1000]
    Illegal BsaI.rc site found at 1043


Overview

This part is made up of psbC and psbA. The psbC gene that comprises this part codes a subunit that makes up the Photosystem II protein P680. The P680 complex is photosystem II primary electron donor. The psbA gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction centre core.

PhotosystemIISynthesis

Biology & Literature

The first gene, psbC encodes CP43 protein which connects with the CP47 encoded by psbB. Along with the CP47, psbC form a proximal antennae. This conducts electron excitation from the external antennae to the PSII core reaction centre [1]. Due to results from deletion studies, the role of the CP43/psbC protein has been described as non-essential for the PSII core assembly [2]. Other studies have found it however helps with the accumulation of the PSII complexes and light harvesting efficiency [2].

The second gene in this part, psbA, encodes the D1 subunit of PSII. Along with the psbD which encodes the D2 subunit, it forms a heterodimer. This forms the PSII reaction centre [3] which is responsible for electron transfer from chlorophyll P680 to quinones QA and QB. It is also vital to the assembly of the oxygen evolving complex and QB within PSII [4].

Protein information

psbC
mass: 50.64kDa
sequence:
METLFNGTLTVGGRDQETTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVSHFVPEKPMYEQGLILLPH IATLGYGVGPGGEIIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESYPFFGYVWKDKNKMTNILGYHLIMLGLGAW LLVWKAMYFGGVYDTWAPGGGDVRVITNPTTNAAVIFGYLVKSPFGGDGWICSVDNMEDIIGGHIWIGTLEILGGIWHIYTT PWPWARRAFVWSGEAYLSYSLGAIGVMGFIACCMSWFNNTAYPSEFYGPTGPEASQSQAFTFLVRDQRLGANVASAQG PTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVA TEINAVNFVSPRSWLACSHFCLGFFFFIGHLWHAGRARAAAAGFEKGIDRFDEPVLSMRPLD

psbA
mass: 30kDa
sequence:
MTAILERRENSSLWARFCEWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVIPTSNA IGLHFYPIWEAASLDEWLYNGGPYQLIVCHFLLGVYCYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFLVYPIGQGSFSD GMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAH GYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGLSTMAFNLNGFNFNQSVVDSQGRVLNTWADIINRANLGMEVMHE
RNAHNFPLDLASTNSSSNN

References

[1] Bricker TM, Frankel LK. The structure and function of CP47 and CP43 in photosystem II. Photosynthesis research. 2002 May 1;72(2):131-46.

[2] Vermaas WF, Ikeuchi M, Inoue Y. Protein composition of the photosystem II core complex in genetically engineered mutants of the cyanobacterium Synechocystis sp. PCC 6803. InMolecular Biology of Photosynthesis 1988 (pp. 389-405). Springer Netherlands.

[3] Marder JB, Chapman DJ, Telfer A, Nixon PJ, Barber J. Identification of psbA and psbD gene products, D1 and D2, as reaction centre proteins of photosystem 2. Plant molecular biology. 1987 Jul 1;9(4):325-33.

[4] Ferreira KN, Iverson TM, Maghlaoui K, Barber J, Iwata S. Architecture of the photosynthetic oxygen-evolving center. Science. 2004 Mar 19;303(5665):1831-8.