Difference between revisions of "Part:BBa K1998004"

 
Line 2: Line 2:
 
__NOTOC__
 
__NOTOC__
 
<partinfo>BBa_K1998004 short</partinfo>
 
<partinfo>BBa_K1998004 short</partinfo>
−
 
−
This part is composed of the psbM, psbZ, psbH, psbW and psbK genes. The psbM protein subunit is positioned at the monomer-monomer interface. The psbZ protein controls the interaction of Photosystem II cores with the light-harvesting antenna. The psbH protein is required for stability and assembly of the photosystem II complex. The psbW protein stabilizes dimeric photosytem II. The psbK protein is also required for stability and assembly of Photosystem II.
 
−
 
−
<!-- Add more about the biology of this part here
 
−
===Usage and Biology===
 
  
 
<!-- -->
 
<!-- -->
Line 17: Line 12:
 
<partinfo>BBa_K1998004 parameters</partinfo>
 
<partinfo>BBa_K1998004 parameters</partinfo>
 
<!-- -->
 
<!-- -->
 +
 +
===Overview===
 +
This part is composed of the psbM, psbZ, psbH, psbW and psbK genes. The psbM protein subunit is positioned at the monomer-monomer interface. The psbZ protein controls the interaction of Photosystem II cores with the light-harvesting antenna. The psbH protein is required for stability and assembly of the photosystem II complex. The psbW protein stabilizes dimeric photosytem II. The psbK protein is also required for stability and assembly of Photosystem II.
 +
<br>
 +
These parts make up one of the operons in our PSII pathway.
 +
<br><br>
 +
<html><center><img src= "https://static.igem.org/mediawiki/2016/a/aa/T--Macquarie_Australia--PhotosystemIISynthesis.png" alt="PhotosystemIISynthesis" height="50%"width="75%"></center></html>
 +
 +
===Biology & Literature===
 +
This biobrick contains one gene from the photosystem II complex of <i>Chlamydomonas reinhardtii</i> - psbD. It is driven by a Plac promoter at the beginning of the sequence, with a RBS preceding the gene, and terminator sequence at the 3' end. The psbD gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core P680 [1, 2]. It has been shown that the psbD gene is highly conserved within <i>C. rienhardtii</i> [3].
 +
<br><br>
 +
Mutations in the psbD gene causes the D2 peptide to not be visible when screened perhaps indicating it's instability within the complex [3]. In addition it was found that other proteins are affected by a mutation in the psbD gene due to the lack of accumulation of other PSII proteins. Therefore the role of psbD is to provide stability in the membrane of the complex as well as to regulate the expression of the D1 protein of the complex [3].
 +
 +
 +
===Protein information===
 +
Protein sequence:
 +
Mass - 43kDa
 +
 +
LEGFTLYASGSYVVWKEVKKQLRSVHIKRNAHGSMTLMTGFVKTVSYSVGQVYYYSLVLTLHVVGLVLLSLLHGIRMVLLLTKVVTSQQLFLHLLTVWLTLFYLFGVQKLKVI
 +
SLVGVNLVVYGHSLLYTVHLVLVSCFVSLKLLVQTYVHTTQLLSQHQLLYSFQYSFTHVNQVGSLHLVSVLLSSVSFYSSKVSTTGHLTHSTWVLLVFVLLYYVLFTVLLLKTH
 +
YSKTVTVLTHSVHSTLHRLKKHTLWLLLTVSGHKSSVLLSLTNVGFTSSCYFQLVFGVLLVLVLTYVLTTSYHKRFVLLKNPEFETFYTKKHSSRKVFLAWKGCFRTNHTKRL
 +
VFSKKIYHRGKPSYITNKRRLAIPGKKRARGSHPRALFFQKX
 +
<br>
 +
 +
===References===
 +
[1] Kim M, Christopher DA, Mullet JE. ADP-Dependent Phosphorylation Regulates Association of a DNA-Binding Complex with the Barley Chloroplast psbDBlue-Light-Responsive Promoter. Plant physiology. 1999 Feb 1;119(2):663-70.
 +
<br>
 +
[2] Rasmussen OF, Bookjans G, Stummann BM, Henningsen KW. Localization and nucleotide sequence of the gene for the membrane polypeptide D2 from pea chloroplast DNA. Plant molecular biology. 1984 Jul 1;3(4):191-9.
 +
<br>
 +
[3] Erickson JM, Rahire M, Malnoë P, Girard-Bascou J, Pierre Y, Bennoun P, Rochaix JD. Lack of the D2 protein in a Chlamydomonas reinhardtii psbD mutant affects photosystem II stability and D1 expression. The EMBO journal. 1986 Aug;5(8):1745.
 +
<br>

Revision as of 04:10, 18 October 2016


psbMZHWK

Sequence and Features


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    COMPATIBLE WITH RFC[21]
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    INCOMPATIBLE WITH RFC[25]
    Illegal NgoMIV site found at 570
  • 1000
    COMPATIBLE WITH RFC[1000]


Overview

This part is composed of the psbM, psbZ, psbH, psbW and psbK genes. The psbM protein subunit is positioned at the monomer-monomer interface. The psbZ protein controls the interaction of Photosystem II cores with the light-harvesting antenna. The psbH protein is required for stability and assembly of the photosystem II complex. The psbW protein stabilizes dimeric photosytem II. The psbK protein is also required for stability and assembly of Photosystem II.
These parts make up one of the operons in our PSII pathway.

PhotosystemIISynthesis

Biology & Literature

This biobrick contains one gene from the photosystem II complex of Chlamydomonas reinhardtii - psbD. It is driven by a Plac promoter at the beginning of the sequence, with a RBS preceding the gene, and terminator sequence at the 3' end. The psbD gene that comprises this part encodes the D2 protein, which is one of the two proteins that comprise the Photosystem II reaction center core P680 [1, 2]. It has been shown that the psbD gene is highly conserved within C. rienhardtii [3].

Mutations in the psbD gene causes the D2 peptide to not be visible when screened perhaps indicating it's instability within the complex [3]. In addition it was found that other proteins are affected by a mutation in the psbD gene due to the lack of accumulation of other PSII proteins. Therefore the role of psbD is to provide stability in the membrane of the complex as well as to regulate the expression of the D1 protein of the complex [3].


Protein information

Protein sequence: Mass - 43kDa

LEGFTLYASGSYVVWKEVKKQLRSVHIKRNAHGSMTLMTGFVKTVSYSVGQVYYYSLVLTLHVVGLVLLSLLHGIRMVLLLTKVVTSQQLFLHLLTVWLTLFYLFGVQKLKVI SLVGVNLVVYGHSLLYTVHLVLVSCFVSLKLLVQTYVHTTQLLSQHQLLYSFQYSFTHVNQVGSLHLVSVLLSSVSFYSSKVSTTGHLTHSTWVLLVFVLLYYVLFTVLLLKTH YSKTVTVLTHSVHSTLHRLKKHTLWLLLTVSGHKSSVLLSLTNVGFTSSCYFQLVFGVLLVLVLTYVLTTSYHKRFVLLKNPEFETFYTKKHSSRKVFLAWKGCFRTNHTKRL VFSKKIYHRGKPSYITNKRRLAIPGKKRARGSHPRALFFQKX

References

[1] Kim M, Christopher DA, Mullet JE. ADP-Dependent Phosphorylation Regulates Association of a DNA-Binding Complex with the Barley Chloroplast psbDBlue-Light-Responsive Promoter. Plant physiology. 1999 Feb 1;119(2):663-70.
[2] Rasmussen OF, Bookjans G, Stummann BM, Henningsen KW. Localization and nucleotide sequence of the gene for the membrane polypeptide D2 from pea chloroplast DNA. Plant molecular biology. 1984 Jul 1;3(4):191-9.
[3] Erickson JM, Rahire M, Malnoë P, Girard-Bascou J, Pierre Y, Bennoun P, Rochaix JD. Lack of the D2 protein in a Chlamydomonas reinhardtii psbD mutant affects photosystem II stability and D1 expression. The EMBO journal. 1986 Aug;5(8):1745.