Difference between revisions of "Part:BBa K1978002"
(6 intermediate revisions by the same user not shown) | |||
Line 3: | Line 3: | ||
<partinfo>BBa_K1978002 short</partinfo> | <partinfo>BBa_K1978002 short</partinfo> | ||
− | The TorA-RFP | + | The TorA-RFP BioBrick consists of a TorA signal linked to RFP, which is fluorescent protein. The TorA signal sequence allows export of fully-folded proteins through the inner membrane via the TAT(Twin-Arginin Translocation) system. This enables export of RFP out of the cell. The TorA sequence codes for a peptide that harbours a twin-arginine motif. This is vital for the recognition by the Tat system. Moreover, an AxA motif is present, which leads to cleavage by the leader peptidase I (Palmer & Berks 2012). |
MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA | MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA | ||
− | <!-- Add more about the biology of this part here | + | <!-- Add more about the biology of this part here --> |
− | + | ||
+ | |||
+ | ===Usage and Biology=== | ||
+ | This BioBrick can be used to test a new organism for compatibility with BioBricks using the standart <i>torA</i> signal sequence from <i>E. coli</i>. | ||
<!-- --> | <!-- --> | ||
+ | |||
+ | |||
<span class='h3bb'>Sequence and Features</span> | <span class='h3bb'>Sequence and Features</span> | ||
<partinfo>BBa_K1978002 SequenceAndFeatures</partinfo> | <partinfo>BBa_K1978002 SequenceAndFeatures</partinfo> |
Latest revision as of 23:12, 17 October 2016
TorA-RFP
The TorA-RFP BioBrick consists of a TorA signal linked to RFP, which is fluorescent protein. The TorA signal sequence allows export of fully-folded proteins through the inner membrane via the TAT(Twin-Arginin Translocation) system. This enables export of RFP out of the cell. The TorA sequence codes for a peptide that harbours a twin-arginine motif. This is vital for the recognition by the Tat system. Moreover, an AxA motif is present, which leads to cleavage by the leader peptidase I (Palmer & Berks 2012). MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA
Usage and Biology
This BioBrick can be used to test a new organism for compatibility with BioBricks using the standart torA signal sequence from E. coli.
Sequence and Features
Assembly Compatibility:
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal AgeI site found at 691
Illegal AgeI site found at 803 - 1000COMPATIBLE WITH RFC[1000]