Difference between revisions of "Part:BBa K1640012"

 
 
(3 intermediate revisions by the same user not shown)
Line 1: Line 1:
 
__NOTOC__
 
 
<partinfo>BBa_K1640012 short</partinfo>
 
<partinfo>BBa_K1640012 short</partinfo>
  
n/a
+
<partinfo>BBa_K1640012 SequenceAndFeatures</partinfo>
  
<!-- Add more about the biology of this part here
+
===Overview===
===Usage and Biology===
+
  
<!-- -->
+
This biobrick contains two genes from the photosystem II complex of ''Chlamydomonas reinhardtii'' - psbQ and psbR, with RBS preceeding each gene.
<span class='h3bb'>Sequence and Features</span>
+
 
<partinfo>BBa_K1640012 SequenceAndFeatures</partinfo>
+
- psbQ is Oxygen-evolving enhancer protein 3<br>
 +
- psbR is a 10 kDa photosystem II polypeptide
 +
 
 +
This part was designed in conjunction with <html><a href="https://parts.igem.org/Part:BBa_K1640022">BBa_K1640022</a></html>, and <html><a href="https://parts.igem.org/Part:BBa_K1640023">BBa_K1640023</a></html>, and together they form operon 5 in our set of photosystem II operons:<br><br>
 +
 
 +
<html><center><img src="https://static.igem.org/mediawiki/parts/thumb/a/a1/Macquarie_PS2_diagram.png/800px-Macquarie_PS2_diagram.png" width="450px" alt="PSII diagram"></center></html>
 +
 
 +
===Biology & Literature===
 +
 
 +
The psbQ gene encodes a 17 kDa protein that is located on the inner side of the thylakoid lumen. Its N-terminus region contains a polyproline II helix (Balsera, M., et al., 2005). It plays an important role in the ability of photosystem II to function in low light conditions (Yi, X., et al., 2006). Studies involving mutant cells have shown that, in the absence of psbQ, their ability to generate oxygen is impaired and psbV is destabilised (Kashino, Y., et al., 2006).
 +
 +
The psbR gene encodes a 10 kDA protein that is essential to the stable assembly of psbP, which is a component of the oxygen-evolving complex of photosystem II. The assembly of psbR is mediated by psbJ (Suorsa, M., et al., 2006). Electron transport in both the donor and the acceptor side of the photosystem II core complex are modified in the absence of this protein (Allahverdiyeva, Y., et al., 2007).
 +
 
 +
===Protein information===
 +
 
 +
'''psbQ'''
 +
 
 +
mass: 19.6kDa
 +
 
 +
sequence: <br>
 +
MASGESRRAVLGGLLASAVAAVAPKAALALTPVDLFDDRSVRDRGFDLIYEARDLDLPQNVREGFTQARASL
 +
DETKKRVKESEARIDADLDVFIQKSYWTEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVE
 +
DLDFALREKDQASAAKKLEITKAKLDSVLAAVL
 +
 
 +
 
 +
'''psbR'''
 +
 
 +
mass: 12.2kDa
 +
 
 +
sequence:<br>
 +
MGGGKTDITKVGLNSIEDPVVKQNLMGKSRFMNKKDWKDASGRKGKGYGVYRYEDKYGANVDGYSPIYTPDL
 +
WTESGDSYTLGTKGLIAWAGLVLVLLAVGVNLIISTSQLGA
 +
 
 +
 
 +
===Part verification===
 +
 
 +
Visualisation of '''psbQR''' showing expected banding is shown in the following gel image, bottom row rightmost set of lanes, with left lane part showing EcoRI digest, right lane showing EcoRI + PstI double digest. This part has been sequenced to confirm design with final  biobrick.
 +
 
 +
<html><center><img src=https://static.igem.org/mediawiki/2015/6/6c/Image_6_results_1_gm_mq.jpg width=450px></center></html>
 +
 
 +
 
 +
 
 +
===References===
 +
 
 +
Allahverdiyeva, Y., Mamedov, F., Suorsa, M., Styring, S., Vass, I., & Aro, E. M. (2007). Insights into the function of PsbR protein in Arabidopsis thaliana. Biochimica et Biophysica Acta (BBA)-Bioenergetics, 1767(6), 677-685.
 +
 
 +
Balsera, M., Arellano, J. B., Revuelta, J. L., De las Rivas, J., & Hermoso, J. A. (2005). The 1.49 Å resolution crystal structure of PsbQ from photosystem II of Spinacia oleracea reveals a PPII structure in the N-terminal region. Journal of molecular biology, 350(5), 1051-1060.
 +
 
 +
Kashino, Y., Inoue-Kashino, N., Roose, J. L., & Pakrasi, H. B. (2006). Absence of the PsbQ protein results in destabilization of the PsbV protein and decreased oxygen evolution activity in cyanobacterial photosystem II. Journal of Biological Chemistry, 281(30), 20834-20841.
  
 +
Suorsa, M., Sirpiö, S., Allahverdiyeva, Y., Paakkarinen, V., Mamedov, F., Styring, S., & Aro, E. M. (2006). PsbR, a missing link in the assembly of the oxygen-evolving complex of plant photosystem II. Journal of Biological Chemistry, 281(1), 145-150.
  
<!-- Uncomment this to enable Functional Parameter display
+
Yi, X., Hargett, S. R., Frankel, L. K., & Bricker, T. M. (2006). The PsbQ protein is required in Arabidopsis for photosystem II assembly/stability and photoautotrophy under low light conditions. Journal of Biological Chemistry, 281(36), 26260-26267.
===Functional Parameters===
+
<partinfo>BBa_K1640012 parameters</partinfo>
+
<!-- -->
+

Latest revision as of 01:37, 19 September 2015

psbQR


Assembly Compatibility:
  • 10
    COMPATIBLE WITH RFC[10]
  • 12
    COMPATIBLE WITH RFC[12]
  • 21
    INCOMPATIBLE WITH RFC[21]
    Illegal BglII site found at 451
    Illegal BglII site found at 780
  • 23
    COMPATIBLE WITH RFC[23]
  • 25
    COMPATIBLE WITH RFC[25]
  • 1000
    INCOMPATIBLE WITH RFC[1000]
    Illegal BsaI site found at 844

Overview

This biobrick contains two genes from the photosystem II complex of Chlamydomonas reinhardtii - psbQ and psbR, with RBS preceeding each gene.

- psbQ is Oxygen-evolving enhancer protein 3
- psbR is a 10 kDa photosystem II polypeptide

This part was designed in conjunction with BBa_K1640022, and BBa_K1640023, and together they form operon 5 in our set of photosystem II operons:

PSII diagram

Biology & Literature

The psbQ gene encodes a 17 kDa protein that is located on the inner side of the thylakoid lumen. Its N-terminus region contains a polyproline II helix (Balsera, M., et al., 2005). It plays an important role in the ability of photosystem II to function in low light conditions (Yi, X., et al., 2006). Studies involving mutant cells have shown that, in the absence of psbQ, their ability to generate oxygen is impaired and psbV is destabilised (Kashino, Y., et al., 2006).

The psbR gene encodes a 10 kDA protein that is essential to the stable assembly of psbP, which is a component of the oxygen-evolving complex of photosystem II. The assembly of psbR is mediated by psbJ (Suorsa, M., et al., 2006). Electron transport in both the donor and the acceptor side of the photosystem II core complex are modified in the absence of this protein (Allahverdiyeva, Y., et al., 2007).

Protein information

psbQ

mass: 19.6kDa

sequence:
MASGESRRAVLGGLLASAVAAVAPKAALALTPVDLFDDRSVRDRGFDLIYEARDLDLPQNVREGFTQARASL DETKKRVKESEARIDADLDVFIQKSYWTEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVE DLDFALREKDQASAAKKLEITKAKLDSVLAAVL


psbR

mass: 12.2kDa

sequence:
MGGGKTDITKVGLNSIEDPVVKQNLMGKSRFMNKKDWKDASGRKGKGYGVYRYEDKYGANVDGYSPIYTPDL WTESGDSYTLGTKGLIAWAGLVLVLLAVGVNLIISTSQLGA


Part verification

Visualisation of psbQR showing expected banding is shown in the following gel image, bottom row rightmost set of lanes, with left lane part showing EcoRI digest, right lane showing EcoRI + PstI double digest. This part has been sequenced to confirm design with final biobrick.


References

Allahverdiyeva, Y., Mamedov, F., Suorsa, M., Styring, S., Vass, I., & Aro, E. M. (2007). Insights into the function of PsbR protein in Arabidopsis thaliana. Biochimica et Biophysica Acta (BBA)-Bioenergetics, 1767(6), 677-685.

Balsera, M., Arellano, J. B., Revuelta, J. L., De las Rivas, J., & Hermoso, J. A. (2005). The 1.49 Å resolution crystal structure of PsbQ from photosystem II of Spinacia oleracea reveals a PPII structure in the N-terminal region. Journal of molecular biology, 350(5), 1051-1060.

Kashino, Y., Inoue-Kashino, N., Roose, J. L., & Pakrasi, H. B. (2006). Absence of the PsbQ protein results in destabilization of the PsbV protein and decreased oxygen evolution activity in cyanobacterial photosystem II. Journal of Biological Chemistry, 281(30), 20834-20841.

Suorsa, M., Sirpiö, S., Allahverdiyeva, Y., Paakkarinen, V., Mamedov, F., Styring, S., & Aro, E. M. (2006). PsbR, a missing link in the assembly of the oxygen-evolving complex of plant photosystem II. Journal of Biological Chemistry, 281(1), 145-150.

Yi, X., Hargett, S. R., Frankel, L. K., & Bricker, T. M. (2006). The PsbQ protein is required in Arabidopsis for photosystem II assembly/stability and photoautotrophy under low light conditions. Journal of Biological Chemistry, 281(36), 26260-26267.