Difference between revisions of "Part:BBa K1640021"
(→Biology & Literature) |
(Updated Biology and Literature section) |
||
Line 22: | Line 22: | ||
===Biology & Literature=== | ===Biology & Literature=== | ||
− | + | PsbW encodes psbW, a low molecular weight subunit of photosystem II (PSII), with a molecular mass of 6.1kDa in C. reinhardtii. PsbW is a transmembrane protein involved in PSII dimer-stabilisation and photoprotection. (Woolhead, Mant, Kim, Robinson, & Rodger, 2001). This protein is tightly associated with the PSII reaction centre (Shi & Schröder, 1997), with deletion studies indicating no dimeric PSII complexes present in psbW-less mutants (Shi, Lorković, Oelmüller, & Schröder, 2000). In addition, psbW-less transgenic plants have demonstrated a higher sensitivity to light-based stress (Thidholm, Shi, & Schroder, 2001). | |
+ | |||
+ | PsbK encodes psbK, a low molecular weight subunit of PSII involved in stabilising the complex, however the necessity of psbK varies between species. In psbK-less C. reinhardtii, the PSII complex was destabilised, with >10% of PSII complex observed, compared to the wild type (Takahashi, Matsumoto, Goldschmidt-Clermont, & Rochaix, 1994). PsbK-less Synechocytis sp., however, only experienced a marginally reduced rate of electron transport and growth (Ikeuchi et al., 1991). In C. reinhardtii, psbK is bound to CP43 (Sugimoto & Takahashi, 2001). | ||
===Protein information=== | ===Protein information=== | ||
Line 40: | Line 42: | ||
===References=== | ===References=== | ||
+ | |||
+ | Ikeuchi, M., Eggers, B., Shen, G., Webber, A., Yu, J., Hirano, A., . . . Vermaas, W. (1991). Cloning of the psbK gene from Synechocystis sp. PCC 6803 and characterization of photosystem II in mutants lacking PSII-K. Journal of Biological Chemistry, 266(17), 11111-11115. | ||
+ | |||
+ | Shi, L.-X., Lorković, Z. J., Oelmüller, R., & Schröder, W. P. (2000). The low molecular mass PsbW protein is involved in the stabilization of the dimeric photosystem II complex in Arabidopsis thaliana. Journal of Biological Chemistry, 275(48), 37945-37950. | ||
+ | |||
+ | Shi, L.-X., & Schröder, W. (1997). Compositional and topological studies of the PsbW protein in spinach thylakoid membrane. Photosynthesis Research, 53(1), 45-53. doi:10.1023/A:1005830405809 | ||
+ | |||
+ | Sugimoto, I., & Takahashi, Y. (2001). Localization of a small chloroplast-encoded polypeptide PsbK in photosystem II core complex. Science Access, 3(1). | ||
+ | |||
+ | Takahashi, Y., Matsumoto, H., Goldschmidt-Clermont, M., & Rochaix, J.-D. (1994). Directed disruption of the Chlamydomonas chloroplast psbK gene destabilizes the photosystem II reaction center complex. Plant molecular biology, 24(5), 779-788. | ||
+ | |||
+ | Thidholm, E., Shi, L.-X., & Schroder, W. (2001). The PsbW-protien; Its location and involvement in photoinhibition. Science Access, 3(1). | ||
+ | |||
+ | Woolhead, C. A., Mant, A., Kim, S. J., Robinson, C., & Rodger, A. (2001). Conformation of a purified “spontaneously” inserting thylakoid membrane protein precursor in aqueous solvent and detergent micelles. Journal of Biological Chemistry, 276(18), 14607-14613. |
Revision as of 00:07, 19 September 2015
psbWK
Sequence and Features
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 74
- 1000COMPATIBLE WITH RFC[1000]
Overview
This biobrick contains two genes from the photosystem II complex of Chlamydomonas reinhardtii - psbW and psbK, with RBS preceeding each gene, and a terminator at the 3' end.
This part was designed in conjunction with BBa_K1640008, and together they form operon 4 in our set of photosystem II operons:
![PSII diagram](https://static.igem.org/mediawiki/parts/thumb/a/a1/Macquarie_PS2_diagram.png/800px-Macquarie_PS2_diagram.png)
Biology & Literature
PsbW encodes psbW, a low molecular weight subunit of photosystem II (PSII), with a molecular mass of 6.1kDa in C. reinhardtii. PsbW is a transmembrane protein involved in PSII dimer-stabilisation and photoprotection. (Woolhead, Mant, Kim, Robinson, & Rodger, 2001). This protein is tightly associated with the PSII reaction centre (Shi & Schröder, 1997), with deletion studies indicating no dimeric PSII complexes present in psbW-less mutants (Shi, Lorković, Oelmüller, & Schröder, 2000). In addition, psbW-less transgenic plants have demonstrated a higher sensitivity to light-based stress (Thidholm, Shi, & Schroder, 2001).
PsbK encodes psbK, a low molecular weight subunit of PSII involved in stabilising the complex, however the necessity of psbK varies between species. In psbK-less C. reinhardtii, the PSII complex was destabilised, with >10% of PSII complex observed, compared to the wild type (Takahashi, Matsumoto, Goldschmidt-Clermont, & Rochaix, 1994). PsbK-less Synechocytis sp., however, only experienced a marginally reduced rate of electron transport and growth (Ikeuchi et al., 1991). In C. reinhardtii, psbK is bound to CP43 (Sugimoto & Takahashi, 2001).
Protein information
psbW
mass: 9.2kDa
sequence: MATTVRSEVAKKVAMLSTLPATLAAHPAFALVDERMNGDGTGRPFGVNDPVLGWVLLGVFGTMWAIWFIGQKDLGDFEDADDGLKL
psbK
mass: 5.0kDa
sequence: MTTLALVLAKLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFR
References
Ikeuchi, M., Eggers, B., Shen, G., Webber, A., Yu, J., Hirano, A., . . . Vermaas, W. (1991). Cloning of the psbK gene from Synechocystis sp. PCC 6803 and characterization of photosystem II in mutants lacking PSII-K. Journal of Biological Chemistry, 266(17), 11111-11115.
Shi, L.-X., Lorković, Z. J., Oelmüller, R., & Schröder, W. P. (2000). The low molecular mass PsbW protein is involved in the stabilization of the dimeric photosystem II complex in Arabidopsis thaliana. Journal of Biological Chemistry, 275(48), 37945-37950.
Shi, L.-X., & Schröder, W. (1997). Compositional and topological studies of the PsbW protein in spinach thylakoid membrane. Photosynthesis Research, 53(1), 45-53. doi:10.1023/A:1005830405809
Sugimoto, I., & Takahashi, Y. (2001). Localization of a small chloroplast-encoded polypeptide PsbK in photosystem II core complex. Science Access, 3(1).
Takahashi, Y., Matsumoto, H., Goldschmidt-Clermont, M., & Rochaix, J.-D. (1994). Directed disruption of the Chlamydomonas chloroplast psbK gene destabilizes the photosystem II reaction center complex. Plant molecular biology, 24(5), 779-788.
Thidholm, E., Shi, L.-X., & Schroder, W. (2001). The PsbW-protien; Its location and involvement in photoinhibition. Science Access, 3(1).
Woolhead, C. A., Mant, A., Kim, S. J., Robinson, C., & Rodger, A. (2001). Conformation of a purified “spontaneously” inserting thylakoid membrane protein precursor in aqueous solvent and detergent micelles. Journal of Biological Chemistry, 276(18), 14607-14613.