Difference between revisions of "Part:BBa K1640023"
Line 13: | Line 13: | ||
===Biology & Literature=== | ===Biology & Literature=== | ||
− | + | PsbO encodes psbO, a 33 kDa protein which acts to stabilise the cluster of four Mn2+ which forms the catalytic centre of the oxygen evolving complex (OEC) (Murata & Miyao, 1985). PsbO consists of an eight strand β-barrel, with a large loop between strands five and 6, which connects the OEC to the luminal surface (Ferreira, Iverson, Maghlaoui, Barber, & Iwata, 2004). Deletion studies of psbO in Synechocystis sp. have shown little effect to photoautotrophic growth and oxygen evolution, however a markedly higher susceptibility to photoinhibition (Mayes, Cook, Self, Zhang, & Barber, 1991). This suggests PsbO is not essential to PSII assembly or water-splitting, however provides protection of PSII from light-induced damage. | |
===Protein information=== | ===Protein information=== | ||
Line 26: | Line 26: | ||
===References=== | ===References=== | ||
+ | |||
+ | Ferreira, K. N., Iverson, T. M., Maghlaoui, K., Barber, J., & Iwata, S. (2004). Architecture of the Photosynthetic Oxygen-Evolving Center. Science, 303(5665), 1831-1838. doi:10.1126/science.1093087 | ||
+ | <br> | ||
+ | <br> | ||
+ | Mayes, S. R., Cook, K. M., Self, S. J., Zhang, Z., & Barber, J. (1991). Deletion of the gene encoding the Photosystem II 33 kDa protein from Synechocystis sp. PCC 6803 does not inactivate water-splitting but increases vulnerability to photoinhibition. Biochimica et Biophysica Acta (BBA) - Bioenergetics, 1060(1), 1-12. doi:http://dx.doi.org/10.1016/S0005-2728(05)80112-4 | ||
+ | <br> | ||
+ | <br> | ||
+ | Murata, N., & Miyao, M. (1985). Extrinsic membrane proteins in the photosynthetic oxygen-evolving complex. Trends in Biochemical Sciences, 10(3), 122-124. doi:http://dx.doi.org/10.1016/0968-0004(85)90272-5 |
Revision as of 23:54, 18 September 2015
psbO
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23COMPATIBLE WITH RFC[23]
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 754
- 1000COMPATIBLE WITH RFC[1000]
Overview
This biobrick contains one gene from the photosystem II complex of Chlamydomonas reinhardtii - psbO, with RBS.
This part was designed in conjunction with BBa_K1640022 and BBa_K1640012 and together they form operon 5 in our set of photosystem II operons:
![PSII diagram](https://static.igem.org/mediawiki/parts/thumb/a/a1/Macquarie_PS2_diagram.png/800px-Macquarie_PS2_diagram.png)
Biology & Literature
PsbO encodes psbO, a 33 kDa protein which acts to stabilise the cluster of four Mn2+ which forms the catalytic centre of the oxygen evolving complex (OEC) (Murata & Miyao, 1985). PsbO consists of an eight strand β-barrel, with a large loop between strands five and 6, which connects the OEC to the luminal surface (Ferreira, Iverson, Maghlaoui, Barber, & Iwata, 2004). Deletion studies of psbO in Synechocystis sp. have shown little effect to photoautotrophic growth and oxygen evolution, however a markedly higher susceptibility to photoinhibition (Mayes, Cook, Self, Zhang, & Barber, 1991). This suggests PsbO is not essential to PSII assembly or water-splitting, however provides protection of PSII from light-induced damage.
Protein information
mass: 27.96kDa
sequence:
MAQKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFC
IEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERV
AFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPARADAEELLKENVKITKALKG
SAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK*
References
Ferreira, K. N., Iverson, T. M., Maghlaoui, K., Barber, J., & Iwata, S. (2004). Architecture of the Photosynthetic Oxygen-Evolving Center. Science, 303(5665), 1831-1838. doi:10.1126/science.1093087
Mayes, S. R., Cook, K. M., Self, S. J., Zhang, Z., & Barber, J. (1991). Deletion of the gene encoding the Photosystem II 33 kDa protein from Synechocystis sp. PCC 6803 does not inactivate water-splitting but increases vulnerability to photoinhibition. Biochimica et Biophysica Acta (BBA) - Bioenergetics, 1060(1), 1-12. doi:http://dx.doi.org/10.1016/S0005-2728(05)80112-4
Murata, N., & Miyao, M. (1985). Extrinsic membrane proteins in the photosynthetic oxygen-evolving complex. Trends in Biochemical Sciences, 10(3), 122-124. doi:http://dx.doi.org/10.1016/0968-0004(85)90272-5