Difference between revisions of "Part:BBa K1415006"
Alex19950425 (Talk | contribs) |
Alex19950425 (Talk | contribs) |
||
Line 19: | Line 19: | ||
Control: Cultural controls, with the exception of the use of Bt cotton and the use of mating disruption and sprays of the Entrust formulation of spinosad are acceptable to use on organically grown cotton. | Control: Cultural controls, with the exception of the use of Bt cotton and the use of mating disruption and sprays of the Entrust formulation of spinosad are acceptable to use on organically grown cotton. | ||
− | [[File: | + | [[File:PCRHAH4.png|right|600px|]] |
[[File:pestHAH.png|leftt|300px|]] | [[File:pestHAH.png|leftt|300px|]] | ||
<!-- Add more about the biology of this part here | <!-- Add more about the biology of this part here |
Revision as of 16:00, 16 October 2014
PBAN (Helicoverpa armigera Hubner)
PBAN (Pheromone Biosynthesis Activating Neuropeptide) is one kind of peptides that can activate biosynthesis of pheromones of insects we target. Once a PBAN binds with the G-protein coupled receptor on an insect’s pheromone gland, the signal send by the G-protein coupled receptor activates the kinase and phosphatase, and then kinase and phosphatase can activate enzymes that participate in the biosynthesis of insect pheromone, which will be emitted.
So,if we ligate the constitutive promoter and ribosome binding site,we can make our E.coli produce our special peptides constantly.
Target insect:Cotton bollworm Helicoverpa armigera (Hubner)
Spread:The pink bollworm has spread to cotton-growing regions throughout the world.
Characteristics: The larva is green, khaki, grey-brown or brown with dark spots. The topside is darker than the bottom side and a yellow or light brown stripe goes round the middle portion by the spots.
Damage: The cotton bollworm is a moth, the larvae of which feed on a wide range of plants, including many important cultivated crops. It is a major pest in cotton and one of the most polyphagous and cosmopolitan pest species. It should not be confused with the similarly named, related species Helicoverpa zea.The cotton bollworm is a highly polyphagous species.The most important crop hosts are tomato, cotton, pigeon pea, chickpea, sorghum and cowpea. Other hosts include groundnut, okra, peas, field beans, soybeans, lucerne, Phaseolus spp., other Leguminosae, tobacco, potatoes, maize, flax, Dianthus, Rosa, Pelargonium, Chrysanthemum, a number of fruit trees, forest trees and a range of vegetable crops.
Control: Cultural controls, with the exception of the use of Bt cotton and the use of mating disruption and sprays of the Entrust formulation of spinosad are acceptable to use on organically grown cotton.
Peptide Sequence: LSDDMPARPADQEMYRQDPEQIDSRTKYFSPRL
- 10COMPATIBLE WITH RFC[10]
- 12COMPATIBLE WITH RFC[12]
- 21COMPATIBLE WITH RFC[21]
- 23INCOMPATIBLE WITH RFC[23]Unknown
- 25INCOMPATIBLE WITH RFC[25]Illegal NgoMIV site found at 18
- 1000COMPATIBLE WITH RFC[1000]